KEGG   Homo sapiens (human): 56956
Entry
56956             CDS       T01001                                 

Gene name
LHX9
Definition
(RefSeq) LIM homeobox 9
  KO
K09373  LIM homeobox protein 2/9
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    56956 (LHX9)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain with LIM region
    56956 (LHX9)
SSDB
Motif
Pfam: LIM Homeodomain Homeobox_KN Homez
Other DBs
NCBI-GeneID: 56956
NCBI-ProteinID: NP_064589
OMIM: 606066
HGNC: 14222
Ensembl: ENSG00000143355
Vega: OTTHUMG00000035656
Pharos: Q9NQ69(Tdark)
UniProt: Q9NQ69
Structure
PDB: 
2DMQ

Position
1q31.3
AA seq 397 aa
MEIVGCRAEDNSCPFRPPAMLFHGISGGHIQGIMEEMERRSKTEARLAKGAQLNGRDAGM
PPLSPEKPALCAGCGGKISDRYYLLAVDKQWHLRCLKCCECKLALESELTCFAKDGSIYC
KEDYYRRFSVQRCARCHLGISASEMVMRARDSVYHLSCFTCSTCNKTLTTGDHFGMKDSL
VYCRAHFETLLQGEYPPQLSYTELAAKSGGLALPYFNGTGTVQKGRPRKRKSPALGVDIV
NYNSGCNENEADHLDRDQQPYPPSQKTKRMRTSFKHHQLRTMKSYFAINHNPDAKDLKQL
AQKTGLTKRVLQVWFQNARAKFRRNLLRQENGGVDKADGTSLPAPPSADSGALTPPGTAT
TLTDLTNPTITVVTSVTSNMDSHESGSPSQTTLTNLF
NT seq 1194 nt   +upstreamnt  +downstreamnt
atggaaatagtggggtgccgagcagaagacaactcgtgtcctttccgccccccagccatg
ctctttcacgggatctccggaggccacatccaaggcatcatggaggagatggagcgcaga
tccaagactgaggcccgtctggccaaaggcgcccagctcaacggccgcgacgcgggcatg
cccccgctcagcccggagaagcccgccctgtgcgccggctgcgggggcaagatctcggac
aggtactatctgctggctgtggacaaacagtggcatctgagatgcctgaagtgctgtgaa
tgtaagctggccctcgagtccgagctcacctgctttgccaaggacggtagcatttactgc
aaggaggattactacagaaggttctctgtgcagagatgtgcccgctgccaccttggcatt
tccgcctcggagatggtcatgcgcgcccgagactctgtctaccacctgagctgcttcacc
tgctccacttgcaacaagactctgaccacgggcgaccatttcggcatgaaggacagcctg
gtgtactgccgcgcccacttcgagaccctcttgcaaggagagtatccaccgcagctgagc
tacacggagctggcggccaagagcggcggcctggccctgccttacttcaacggtacgggc
accgtgcagaaagggcggccccggaagcggaagagcccagcgctgggagtggacatcgtc
aattacaactcaggttgtaatgagaatgaggcagaccacttggaccgggaccagcagcct
tatccaccctcgcagaagaccaagcgcatgcgaacctctttcaagcatcaccagctccgg
accatgaaatcctactttgccatcaaccacaacccggatgccaaggacctcaagcagctt
gcccagaaaacaggtctgaccaaaagagttttgcaggtttggttccaaaacgcacgagcc
aaattcagaaggaaccttttgcggcaggagaatgggggtgttgataaagctgacggcacg
tcgcttccggccccgccctcagcagacagcggagctctcactccacccggcactgcgacc
actttaacagacctgaccaatcccactatcactgtagtgacatccgtgacctctaacatg
gacagccacgaatccggaagcccctcacaaactaccttaacaaaccttttctaa

DBGET integrated database retrieval system