KEGG   Homo sapiens (human): 56957
Entry
56957             CDS       T01001                                 
Symbol
OTUD7B, CEZANNE, ZA20D1
Name
(RefSeq) OTU deubiquitinase 7B
  KO
K11860  OTU domain-containing protein 7 [EC:3.4.19.12]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    56957 (OTUD7B)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    56957 (OTUD7B)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     56957 (OTUD7B)
Peptidases and inhibitors [BR:hsa01002]
 Cysteine peptidases
  Family C64
   56957 (OTUD7B)
Ubiquitin system [BR:hsa04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   OTU
    56957 (OTUD7B)
SSDB
Motif
Pfam: OTU zf-A20 UBA_4 TAP_C DUF4778
Other DBs
NCBI-GeneID: 56957
NCBI-ProteinID: NP_064590
OMIM: 611748
HGNC: 16683
Ensembl: ENSG00000264522
Pharos: Q6GQQ9(Tbio)
UniProt: Q6GQQ9
Structure
Position
1:complement(149937812..150067653)
AA seq 843 aa
MTLDMDAVLSDFVRSTGAEPGLARDLLEGKNWDVNAALSDFEQLRQVHAGNLPPSFSEGS
GGSRTPEKGFSDREPTRPPRPILQRQDDIVQEKRLSRGISHASSSIVSLARSHVSSNGGG
GGSNEHPLEMPICAFQLPDLTVYNEDFRSFIERDLIEQSMLVALEQAGRLNWWVSVDPTS
QRLLPLATTGDGNCLLHAASLGMWGFHDRDLMLRKALYALMEKGVEKEALKRRWRWQQTQ
QNKESGLVYTEDEWQKEWNELIKLASSEPRMHLGTNGANCGGVESSEEPVYESLEEFHVF
VLAHVLRRPIVVVADTMLRDSGGEAFAPIPFGGIYLPLEVPASQCHRSPLVLAYDQAHFS
ALVSMEQKENTKEQAVIPLTDSEYKLLPLHFAVDPGKGWEWGKDDSDNVRLASVILSLEV
KLHLLHSYMNVKWIPLSSDAQAPLAQPESPTASAGDEPRSTPESGDSDKESVGSSSTSNE
GGRRKEKSKRDREKDKKRADSVANKLGSFGKTLGSKLKKNMGGLMHSKGSKPGGVGTGLG
GSSGTETLEKKKKNSLKSWKGGKEEAAGDGPVSEKPPAESVGNGGSKYSQEVMQSLSILR
TAMQGEGKFIFVGTLKMGHRHQYQEEMIQRYLSDAEERFLAEQKQKEAERKIMNGGIGGG
PPPAKKPEPDAREEQPTGPPAESRAMAFSTGYPGDFTIPRPSGGGVHCQEPRRQLAGGPC
VGGLPPYATFPRQCPPGRPYPHQDSIPSLEPGSHSKDGLHRGALLPPPYRVADSYSNGYR
EPPEPDGWAGGLRGLPPTQTKCKQPNCSFYGHPETNNFCSCCYREELRRREREPDGELLV
HRF
NT seq 2532 nt   +upstreamnt  +downstreamnt
atgaccctggacatggatgctgttctgtcagattttgtccgttccacaggagcagagcca
gggctagcgcgagatctcctagaaggaaagaattgggatgtgaatgccgccctcagtgat
tttgaacagctacgtcaagtccatgctggaaacctacccccatcctttagtgaggggagt
ggtggctccaggacccctgaaaaagggttttctgacagagagcctactcgccctccccga
cccatcctccagcggcaggatgacatcgttcaagaaaaacgcctgtctaggggcatctcc
cacgccagctccagcattgtttccctggcccggtcccatgtctcctccaatggtgggggt
ggggggagcaatgagcaccccctggaaatgcccatctgtgccttccagcttccagatctc
actgtatacaatgaagacttccgcagcttcatagagagagacctcattgagcagtccatg
ctggttgccttggaacaggcagggcgtttgaactggtgggtgagtgtggatcccacctct
cagaggctgcttcctttggcaactactggagatgggaactgcctcctgcatgcagcctcc
cttggaatgtggggtttccatgatcgggacttgatgctgcggaaagctttgtatgcactg
atggagaagggagttgagaaggaagcgttgaaaaggcgctggaggtggcagcagacacag
cagaataaagagtcagggctggtatacacagaagatgaatggcagaaggagtggaatgaa
ctgatcaagcttgcctcaagtgaaccccgaatgcatctaggtaccaatggagccaactgt
ggtggggtggagagttctgaggagcctgtatatgagagccttgaagagtttcacgtcttt
gtccttgctcatgtgcttaggaggcccatagtcgtcgtggcagacaccatgctgagggac
tccggaggggaagcatttgcccctattccctttggaggaatctatctgcctttggaggtc
ccagccagccagtgtcaccgctcccctctggtgctcgcctatgatcaggcccacttttct
gcactcgtgtccatggagcagaaggagaataccaaggaacaagctgtgatcccacttaca
gattcagagtataagctgctgcccttgcactttgctgtggaccctggaaagggctgggag
tggggcaaagatgatagtgacaatgtccgattggccagtgtaattctgtccctagaggtc
aaattgcatctgctgcatagctacatgaatgtgaagtggatcccactgtcctctgatgca
caggctcctctggcccagcctgagtcccccaccgcctcagctggagatgagccccggtcc
actcctgagtctggagactcagacaaggagtcagttggcagcagttccaccagcaacgag
ggcggccggcggaaggagaagtcaaagcgagatcgggagaaggacaagaagagagcagat
tctgtggctaacaaactgggcagctttggcaaaaccttgggcagcaagctcaagaagaac
atggggggcctgatgcacagcaagggttcaaagcctggaggggtggggacagggttggga
ggaagcagcggcactgagacactggagaagaagaagaaaaactcactgaagagctggaag
ggtggcaaggaggaggcagctggggatgggcctgtgtctgagaagcccccagctgagtct
gttggtaacggagggagcaagtatagccaggaggtgatgcagagcctgagcattctgagg
actgccatgcaaggggaggggaagtttatttttgttggaaccctgaagatgggtcaccgt
caccagtatcaggaggaaatgatccagcgctacctttctgatgctgaggagagattcctg
gcagaacagaagcagaaggaggcagagaggaagatcatgaatggaggaatagggggtggc
cctcctccagccaaaaagccagagccagatgctagggaagagcagccgaccggtccccca
gcagagtccagggcaatggcattttccactggctaccctggggactttactatccctcgg
ccgtctgggggcggagtccactgccaggaaccccggaggcagttggcagggggtccatgt
gtcgggggcctaccaccatatgccaccttccccagacagtgccctcctgggcgaccctac
ccccaccaggacagcatcccttctctggagccaggcagccactctaaggatggacttcac
aggggtgccttgttaccacccccctaccgagtggctgattcctatagcaatggctacaga
gagccccctgagccagatggatgggctggaggtctccggggccttcccccaactcagacc
aaatgcaaacaaccgaactgcagcttctatggacaccctgagacaaacaacttctgttcc
tgttgttacagggaagaactgaggaggagggagcgggaaccggatggggagctcctggtg
cacaggttctga

DBGET integrated database retrieval system