KEGG   Homo sapiens (human): 5697
Entry
5697              CDS       T01001                                 

Gene name
PYY, PYY-I, PYY1
Definition
(RefSeq) peptide YY
  KO
K05233  peptide YY
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    5697 (PYY)
SSDB
Motif
Pfam: Hormone_3 DUF4733 bpX0
Other DBs
NCBI-GeneID: 5697
NCBI-ProteinID: NP_004151
OMIM: 600781
HGNC: 9748
Ensembl: ENSG00000131096
Vega: OTTHUMG00000181801
Pharos: P10082(Tbio)
CPD: C16118
UniProt: P10082
Structure
PDB: 
2NA5

Position
17q21.31
AA seq 97 aa
MVFVRRPWPALTTVLLALLVCLGALVDAYPIKPEAPREDASPEELNRYYASLRHYLNLVT
RQRYGKRDGPDTLLSKTFFPDGEDRPVRSRSEGPDLW
NT seq 294 nt   +upstreamnt  +downstreamnt
atggtgttcgtgcgcaggccgtggcccgccttgaccacagtgcttctggccctgctcgtc
tgcctaggggcgctggtcgacgcctaccccatcaaacccgaggctccccgcgaagacgcc
tcgccggaggagctgaaccgctactacgcctccctgcgccactacctcaacctggtcacc
cggcagcggtatgggaaaagagacggcccggacacgcttctttccaaaacgttcttcccc
gacggcgaggaccgccccgtcaggtcgcggtcggagggcccagacctgtggtga

DBGET integrated database retrieval system