KEGG   Homo sapiens (human): 56978Help
Entry
56978             CDS       T01001                                 

Gene name
PRDM8, EPM10, KMT8D, PFM5
Definition
(RefSeq) PR/SET domain 8
  KO
K20797  PR domain zinc finger protein 8 [EC:2.1.1.-]
Organism
hsa  Homo sapiens (human)
Disease
H00810  Progressive myoclonic epilepsy
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    56978 (PRDM8)
Enzymes [BR:hsa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.-  
     56978 (PRDM8)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     56978 (PRDM8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-C2H2_4 zf-C2H2 zf-H2C2_2 SET zf-C2H2_2 K_channel_TID Zn-C2H2_12 zf-C2H2_6 zf-C2H2_9 zf-LYAR
Motif
Other DBs
NCBI-GeneID: 56978
NCBI-ProteinID: NP_001092873
OMIM: 616639
HGNC: 13993
Ensembl: ENSG00000152784
Vega: OTTHUMG00000160885
Pharos: Q9NQV8(Tdark)
UniProt: Q9NQV8 A0A024RDC4 Q05CA1
Position
4q21.21
AA seq 689 aa AA seqDB search
MEDTGIQRGIWDGDAKAVQQCLTDIFTSVYTTCDIPENAIFGPCVLSHTSLYDSIAFIAL
KSTDKRTVPYIFRVDTSAANGSSEGLMWLRLVQSARDKEEQNLEAYIKNGQLFYRSLRRI
AKDEELLVWYGKELTELLLLCPSRSHNKMNGSSPYTCLECSQRFQFEFPYVAHLRFRCPK
RLHSADISPQDEQGGGVGTKDHGGGGGGGKDQQQQQQEAPLGPGPKFCKAGPLHHYPSPS
PESSNPSAAAGGSSAKPSTDFHNLARELENSRGGSSCSPAQSLSSGSGSGGGGGHQEAEL
SPDGIATGGGKGKRKFPEEAAEGGGGAGLVGGRGRFVERPLPASKEDLVCTPQQYRASGS
YFGLEENGRLFAPPSPETGEAKRSAFVEVKKAARAASLQEEGTADGAGVASEDQDAGGGG
GSSTPAAASPVGAEKLLAPRPGGPLPSRLEGGSPARGSAFTSVPQLGSAGSTSGGGGTGA
GAAGGAGGGQGAASDERKSAFSQPARSFSQLSPLVLGQKLGALEPCHPADGVGPTRLYPA
AADPLAVKLQGAADLNGGCGSLPSGGGGLPKQSPFLYATAFWPKSSAAAAAAAAAAAAGP
LQLQLPSALTLLPPSFTSLCLPAQNWCAKCNASFRMTSDLVYHMRSHHKKEYAMEPLVKR
RREEKLKCPICNESFRERHHLSRHMTSHN
NT seq 2070 nt NT seq  +upstreamnt  +downstreamnt
atggaggatactggcatccagcgaggcatctgggatggagatgccaaggctgtccaacaa
tgtctgacagatatttttaccagcgtttacaccacctgcgacatccctgagaatgctata
tttggtccctgtgtcctgagccatacttccctatatgacagcatagctttcatagctctc
aagtctactgacaagagaacagtaccgtatatctttcgggtagacacctcagcagcaaat
ggttcctcagaaggtctcatgtggctgcggttggtccaatcggccagagataaggaagag
cagaaccttgaagcctacataaaaaacggacagctgttctaccgctctctccgcaggatt
gccaaagacgaggagttactagtttggtacgggaaagaactgactgagttactcttgctc
tgcccctctagatcccacaacaaaatgaatgggtcgtccccttacacatgcctggaatgc
agccaacgtttccagtttgagttcccctatgtggcgcatctgcgtttccgctgccccaag
agacttcacagcgctgatataagtccccaagacgaacaaggcggcggcgtgggcaccaag
gaccacgggggcggcggcggcggtggcaaagaccagcagcagcagcagcaggaggcacct
ttaggcccgggtcccaagttttgcaaagccggccccctccaccactacccatccccctcc
ccggaaagcagcaacccatccgctgccgccggcggcagcagcgcgaagccatccacagac
ttccacaacctggccagggagctggaaaactcccggggaggcagcagctgctccccagcc
cagagcctcagcagcggtagcggcagcggcggcggcggcggccaccaggaggcggagctg
agtcccgacggcatcgccacgggcggcggcaaaggaaagaggaaattcccggaggaggcg
gcggagggcggcggtggcgctggtctggtagggggccggggccgcttcgtagagcggccc
ctcccggcctccaaggaggatctggtgtgcacaccgcagcagtaccgagcctcgggcagc
tacttcggcctggaagagaacggccgcctcttcgcgccgccaagtcccgagacgggcgag
gcgaagcgcagcgccttcgtggaggtgaagaaggctgcccgcgcggccagcctgcaggag
gaggggacagccgacggcgcgggagtcgcctccgaggaccaggacgctggcggcggcggc
ggctcctccacgcccgcggccgcgtcaccggtgggcgccgagaagctgctggccccgcgg
cctgggggcccgctgcccagccggctcgagggcggcagtcctgcgaggggcagcgccttc
acttcggtgccgcagctgggcagcgcgggcagcaccagcggtgggggcggaacgggcgcc
ggggccgcaggcggcgcgggcgggggccagggcgccgcgtcggacgagcgcaaaagcgcc
ttctcgcagccagcacgctctttctcgcagctgtccccgctggtgctgggccagaagctg
ggcgcgctcgagccatgccaccccgccgacggcgtgggccccaccagactctatcccgcc
gccgcggaccctctagcggtgaagctccagggggccgcggacctgaacggaggttgcggg
tccctgccgagcggcggcggcggcctgcctaagcagagccccttcctgtacgccaccgcc
ttctggcccaagagctccgctgccgctgcagccgcggctgcggcggcggccgcggggccc
ttgcagctgcagctgccctcggcgctcacgctgctgccgccctccttcacctcgctgtgt
ctgcccgcgcagaactggtgcgccaagtgcaatgcctccttccgcatgacctccgacctg
gtgtaccatatgaggtcgcaccacaaaaaggagtatgcgatggagcccttggtgaagcgg
cggcgagaggagaaactcaagtgccccatctgcaatgagtccttcagggagcgccaccac
ctctccaggcacatgacctcgcataattga

DBGET integrated database retrieval system