KEGG   Homo sapiens (human): 56979Help
Entry
56979             CDS       T01001                                 

Gene name
PRDM9, KMT8B, MEISETZ, MSBP3, PFM6, ZNF899
Definition
(RefSeq) PR/SET domain 9
  KO
K20796  [histone H3]-lysine4 N-trimethyltransferase PRDM7/9 [EC:2.1.1.354]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00310  Lysine degradation
hsa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    56979 (PRDM9)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    56979 (PRDM9)
Enzymes [BR:hsa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.354  [histone H3]-lysine4 N-trimethyltransferase
     56979 (PRDM9)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     56979 (PRDM9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 SSXRD Zn-ribbon_8 zinc_ribbon_15 KRAB SET zf-C2H2_6 DUF3268 zf_PR_Knuckle Phage_F
Motif
Other DBs
NCBI-GeneID: 56979
NCBI-ProteinID: NP_001297143
OMIM: 609760
HGNC: 13994
Ensembl: ENSG00000164256
Vega: OTTHUMG00000161918
Pharos: Q9NQV7(Tbio)
UniProt: Q9NQV7
Structure
PDB: 

Position
5p14.2
AA seq 894 aa AA seqDB search
MSPEKSQEESPEEDTERTERKPMVKDAFKDISIYFTKEEWAEMGDWEKTRYRNVKRNYNA
LITIGLRATRPAFMCHRRQAIKLQVDDTEDSDEEWTPRQQVKPPWMALRVEQRKHQKGMP
KASFSNESSLKELSRTANLLNASGSEQAQKPVSPSGEASTSGQHSRLKLELRKKETERKM
YSLRERKGHAYKEVSEPQDDDYLYCEMCQNFFIDSCAAHGPPTFVKDSAVDKGHPNRSAL
SLPPGLRIGPSGIPQAGLGVWNEASDLPLGLHFGPYEGRITEDEEAANNGYSWLITKGRN
CYEYVDGKDKSWANWMRYVNCARDDEEQNLVAFQYHRQIFYRTCRVIRPGCELLVWYGDE
YGQELGIKWGSKWKKELMAGREPKPEIHPCPSCCLAFSSQKFLSQHVERNHSSQNFPGPS
ARKLLQPENPCPGDQNQEQQYPDPHSRNDKTKGQEIKERSKLLNKRTWQREISRAFSSPP
KGQMGSCRVGKRIMEEESRTGQKVNPGNTGKLFVGVGISRIAKVKYGECGQGFSVKSDVI
THQRTHTGEKLYVCRECGRGFSWKSHLLIHQRIHTGEKPYVCRECGRGFSWQSVLLTHQR
THTGEKPYVCRECGRGFSRQSVLLTHQRRHTGEKPYVCRECGRGFSRQSVLLTHQRRHTG
EKPYVCRECGRGFSWQSVLLSHQRTHTGEKPYVCRECGRGFSWQSVLLTHQRTHTGEKPY
VCRECGRGFSNKSHLLRHQRTHTGEKPYVCRECGRGFRDKSHLLRHQRTHTGEKPYVCRE
CGRGFRDKSNLLSHQRTHTGEKPYVCRECGRGFSNKSHLLRHQRTHTGEKPYVCRECGRG
FRNKSHLLRHQRTHTGEKPYVCRECGRGFSDRSSLCYHQRTHTGEKPYVCREDE
NT seq 2685 nt NT seq  +upstreamnt  +downstreamnt
atgagccctgaaaagtcccaagaggagagcccagaagaagacacagagagaacagagcgg
aagcccatggtcaaagatgccttcaaagacatttccatatacttcaccaaggaagaatgg
gcagagatgggagactgggagaaaactcgctataggaatgtgaaaaggaactataatgca
ctgattactataggtctcagagccactcgaccagctttcatgtgtcaccgaaggcaggcc
atcaaactccaggtggatgacacagaagattctgatgaagaatggacccctaggcagcaa
gtcaaacctccttggatggccttaagagtggaacagcgtaaacaccagaagggaatgccc
aaggcgtcattcagtaatgaatctagtttgaaagaattgtcaagaacagcaaatttactg
aatgcaagtggctcagagcaggctcagaaaccagtgtccccttctggagaagcaagtacc
tctggacagcactcaagactaaaactggaactcaggaagaaggagactgaaagaaagatg
tatagcctgcgagaaagaaagggtcatgcatacaaagaggtcagcgagccgcaggatgat
gattacctctattgtgagatgtgtcagaacttcttcattgacagctgtgctgcccatggg
ccccctacatttgtaaaggacagtgcagtggacaaggggcaccccaaccgttcagccctc
agtctgcccccagggctgagaattgggccatcaggcatccctcaggctgggcttggagta
tggaatgaggcatctgatctgccgctgggtctgcactttggcccttatgagggccgaatt
acagaagacgaagaggcagccaacaatggatactcctggctgatcaccaaggggagaaac
tgctatgagtatgtggatggaaaagataaatcctgggccaactggatgaggtatgtgaac
tgtgcccgggatgatgaagagcagaacctggtggccttccagtaccacaggcagatcttc
tatagaacctgccgagtcattaggccaggctgtgaactgctggtctggtatggggatgaa
tacggccaggaactgggcatcaagtggggcagcaagtggaagaaagagctcatggcaggg
agagaaccaaagccagagatccatccatgtccctcatgctgtctggccttttcaagtcag
aaatttctcagtcaacatgtagaacgcaatcactcctctcagaacttcccaggaccatct
gcaagaaaactcctccaaccagagaatccctgcccaggggatcagaatcaggagcagcaa
tatccagatccacacagccgtaatgacaaaaccaaaggtcaagagatcaaagaaaggtcc
aaactcttgaataaaaggacatggcagagggagatttcaagggccttttctagcccaccc
aaaggacaaatggggagctgtagagtgggaaaaagaataatggaagaagagtccagaaca
ggccagaaagtgaatccagggaacacaggcaaattatttgtgggggtaggaatctcaaga
attgcaaaagtcaagtatggagagtgtggacaaggtttcagtgttaaatcagatgttatt
acacaccaaaggacacatacaggggagaagctctacgtctgcagggagtgtgggcggggc
tttagctggaagtcacacctcctcattcaccagaggatacacacaggggagaagccctat
gtctgcagggagtgtgggcggggctttagctggcagtcagtcctcctcactcaccagagg
acacacacaggggagaagccctatgtctgcagggagtgtgggcggggctttagccggcag
tcagtcctcctcactcaccagaggagacacacaggggagaagccctatgtctgcagggag
tgtgggcggggctttagccggcagtcagtcctcctcactcaccagaggagacacacaggg
gagaagccctatgtctgcagggagtgtgggcggggctttagctggcagtcagtcctcctc
agtcaccagaggacacacacaggggagaagccctatgtctgcagggagtgtgggcggggc
tttagctggcagtcagtcctcctcactcaccagaggacacacacaggggagaagccctat
gtctgcagggagtgtgggcggggctttagcaataagtcacacctcctcagacaccagagg
acacacacaggggagaagccctatgtctgcagggagtgtgggcggggctttcgcgataag
tcacacctcctcagacaccagaggacacacacaggggagaagccctatgtctgcagggag
tgtgggcggggctttagagataagtcaaacctcctcagtcaccagaggacacacacaggg
gagaagccctatgtctgcagggagtgtgggcggggctttagcaataagtcacacctcctc
agacaccagaggacacacacaggggagaagccctatgtctgcagggagtgtgggcggggc
tttcgcaataagtcacacctcctcagacaccagaggacacacacaggggagaagccctac
gtctgcagggagtgtgggcggggctttagcgataggtcaagcctctgctatcaccagagg
acacacacaggggagaagccctacgtctgcagggaggatgagtaa

DBGET integrated database retrieval system