KEGG   Homo sapiens (human): 5698Help
Entry
5698              CDS       T01001                                 

Gene name
PSMB9, LMP2, PRAAS3, PSMB6i, RING12, beta1i
Definition
(RefSeq) proteasome subunit beta 9
  KO
K02741  20S proteasome subunit beta 9 [EC:3.4.25.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa03050  Proteasome
Module
hsa_M00337  Immunoproteasome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    5698 (PSMB9)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:hsa01002]
    5698 (PSMB9)
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:hsa03051]
    5698 (PSMB9)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.25  Threonine endopeptidases
    3.4.25.1  proteasome endopeptidase complex
     5698 (PSMB9)
Peptidases [BR:hsa01002]
 Threonine Peptidases
  Family T1: proteasome family
   5698 (PSMB9)
Proteasome [BR:hsa03051]
 Eukaryotic proteasome
  Core particles (20S proteasome)
   beta type subunits
    5698 (PSMB9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Proteasome
Motif
Other DBs
NCBI-GeneID: 5698
NCBI-ProteinID: NP_002791
OMIM: 177045
HGNC: 9546
Ensembl: ENSG00000240065
Vega: OTTHUMG00000031287
Pharos: P28065(Tchem)
UniProt: P28065 A0A1U9X8D7
Structure
PDB: 

Position
6p21.32
AA seq 219 aa AA seqDB search
MLRAGAPTGDLPRAGEVHTGTTIMAVEFDGGVVMGSDSRVSAGEAVVNRVFDKLSPLHER
IYCALSGSAADAQAVADMAAYQLELHGIELEEPPLVLAAANVVRNISYKYREDLSAHLMV
AGWDQREGGQVYGTLGGMLTRQPFAIGGSGSTFIYGYVDAAYKPGMSPEECRRFTTDAIA
LAMSRDGSSGGVIYLVTITAAGVDHRVILGNELPKFYDE
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgggcgggagcaccaaccggggacttaccccgggcgggagaagtccacaccggg
accaccatcatggcagtggagtttgacgggggcgttgtgatgggttctgattcccgagtg
tctgcaggcgaggcggtggtgaaccgagtgtttgacaagctgtccccgctgcacgagcgc
atctactgtgcactctctggttcagctgctgatgcccaagccgtggccgacatggccgcc
taccagctggagctccatgggatagaactggaggaacctccacttgttttggctgctgca
aatgtggtgagaaatatcagctataaatatcgagaggacttgtctgcacatctcatggta
gctggctgggaccaacgtgaaggaggtcaggtatatggaaccctgggaggaatgctgact
cgacagccttttgccattggtggctccggcagcacctttatctatggttatgtggatgca
gcatataagccaggcatgtctcccgaggagtgcaggcgcttcaccacagacgctattgct
ctggccatgagccgggatggctcaagcgggggtgtcatctacctggtcactattacagct
gccggtgtggaccatcgagtcatcttgggcaatgaactgccaaaattctatgatgagtga

DBGET integrated database retrieval system