KEGG   Homo sapiens (human): 56980
Entry
56980             CDS       T01001                                 

Gene name
PRDM10, PFM7, TRIS
Definition
(RefSeq) PR/SET domain 10
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: Tristanin_u2 zf-C2H2 zf-C2H2_4 zf-H2C2_2 zf-C2H2_jaz zf-C2H2_2 zf-C2H2_6 zf-met zf_PR_Knuckle zf-Di19 zf-C2H2_12 zf-BED SET DUF629 DUF4428 zf_C2H2_ZHX
Other DBs
NCBI-GeneID: 56980
NCBI-ProteinID: NP_955469
OMIM: 618319
HGNC: 13995
Ensembl: ENSG00000170325
Vega: OTTHUMG00000165762
Pharos: Q9NQV6(Tbio)
UniProt: Q9NQV6
Structure
PDB: 
3IHX

Position
11q24.3
AA seq 1156 aa
MDSKDESSHVWPTSAEHEQNAAQVHFVPDTGTVAQIVYTDDQVRPPQQVVYTADGASYTS
VDGPEHTLVYIHPVEAAQTLFTDPGQVAYVQQDATAQQASLPVHNQVLPSIESVDGSDPL
ATLQTPLGRLEAKEEEDEDEDEDTEEDEEEDGEDTDLDDWEPDPPRPFDPHDLWCEECNN
AHASVCPKHGPLHPIPNRPVLTRARASLPLVLYIDRFLGGVFSKRRIPKRTQFGPVEGPL
VRGSELKDCYIHLKVSLDKGDRKERDLHEDLWFELSDETLCNWMMFVRPAQNHLEQNLVA
YQYGHHVYYTTIKNVEPKQELKVWYAASYAEFVNQKIHDISEEERKVLREQEKNWPCYEC
NRRFISSEQLQQHLNSHDEKLDVFSRTRGRGRGRGKRRFGPGRRPGRPPKFIRLEITSEN
GEKSDDGTQDLLHFPTKEQFDEAEPATLNGLDQPEQTTIPIPQLPQETQSSLEHEPETHT
LHLQPQHEESVVPTQSTLTADDMRRAKRIRNAALQHLFIRKSFRPFKCLQCGKAFREKDK
LDQHLRFHGREGNCPLTCDLCNKGFISSTSLESHMKLHSDQKTYSCIFCPESFDRLDLLK
DHVAIHINDGYFTCPTCKKRFPDFIQVKKHVRSFHSEKIYQCTECDKAFCRPDKLRLHML
RHSDRKDFLCSTCGKQFKRKDKLREHMQRMHNPEREAKKADRISRSKTFKPRITSTDYDS
FTFKCRLCMMGFRRRGMLVNHLSKRHPDMKIEEVPELTLPIIKPNRDYFCQYCDKVYKSA
SKRKAHILKNHPGAELPPSIRKLRPAGPGEPDPMLSTHTQLTGTIATPPVCCPHCSKQYS
SKTKMVQHIRKKHPEFAQLSNTIHTPLTTAVISATPAVLTTDSATGETVVTTDLLTQAMT
ELSQTLTTDYRTPQGDYQRIQYIPVSQSASGLQQPQHIQLQVVQVASATSPHQSQQSTVD
VGQLHDPQPYPQHAIQVQHIQVSEPTASAPSSAQVSGQPLSPSAQQAQQGLSPSHIQGSS
STQGQALQQQQQQQQNSSVQHTYLPSAWNSFRGYSSEIQMMTLPPGQFVITDSGVATPVT
TGQVKAVTSGHYVLSESQSELEEKQTSALSGGVQVEPPAHSDSLDPQTNSQQQTTQYIIT
TTTNGNGSSEVHITKP
NT seq 3471 nt   +upstreamnt  +downstreamnt
atggattccaaagatgaaagctcgcatgtgtggccgacatctgcagagcatgaacagaat
gccgcacaggtgcactttgttccggacacaggaacagtggctcagattgtctataccgat
gaccaggttcgccccccacagcaggtggtgtacacggcagatggtgcctcctacacatca
gtggatggtccagagcacacgctggtgtacatccacccggtggaagctgcacagactctg
tttacagaccccggccaggtagcttatgtccaacaggatgctacagctcagcaggcctca
ttgccagttcataaccaggtgctgccttccatcgagagtgtagatgggtccgaccctttg
gcaactctgcagacccctctaggcagactggaggccaaagaggaagaggatgaggatgag
gacgaggacactgaggaagatgaggaagaagacggtgaggacacggatctggatgactgg
gagccagacccgccccggcccttcgacccacacgacttgtggtgtgaggagtgcaataac
gcgcatgcttcagtgtgtccgaagcacggccccttgcacccgatccccaaccggccggtg
ctcacccgggccagggcgagcctccccctggtgctctacatagacaggtttctgggcggg
gtgttctccaagcggcgcatccccaagcgcacccagtttggccccgtggaggggcctctc
gtcaggggctcggagctgaaagactgttacattcacctcaaggtttctcttgataaaggg
gacaggaaagaaagggatttacatgaagacctatggtttgagttgtctgatgagacgctt
tgtaactggatgatgtttgtacggccagcccagaatcacctggagcagaacctggtggct
taccagtatggccaccatgtgtattatacaaccataaaaaatgtggagcccaagcaggaa
ctgaaggtgtggtatgccgcatcctatgctgagttcgtgaaccagaaaattcatgacatt
tctgaggaagaaaggaaagttcttcgagagcaagagaagaattggccctgctatgaatgt
aaccgccgatttataagctcggagcagttgcaacagcatctcaattctcatgatgagaaa
ctagatgtgtttagcagaacaagaggcagaggaaggggacgaggcaagaggcgattcggt
ccaggtcgacggccggggcgtcctccaaaatttatccgcctggaaatcaccagcgaaaat
ggggaaaagagtgacgatgggacacaggacttgctacattttcccacaaaggagcaattt
gatgaggctgaaccagccactctgaatgggctggatcaaccagaacagaccactatccca
atccctcagctgccacaggaaacccagtcttccctggaacatgaaccagaaactcacacc
ctgcacctgcagccgcagcatgaagagagcgtggtgcccacccagagcacgctgacagcc
gacgacatgcgcagagccaagcgcatccgaaatgcagctcttcagcatctgtttattcgg
aagtccttccggccttttaaatgcttgcagtgtgggaaggccttccgggaaaaggacaaa
ctggaccagcacttacgcttccatgggcgggaggggaactgcccactgacctgtgatctc
tgtaacaagggcttcatcagcagcacatccttggagagccacatgaagctccactcagac
cagaagacttactcttgcattttttgcccagaatcctttgaccgccttgatttgttgaaa
gatcatgtggccattcatatcaatgatggctacttcacctgcccaacttgtaagaaacgg
ttcccagattttatccaggtgaaaaaacacgtgcgcagcttccactcagaaaagatctac
cagtgcacagagtgtgacaaggccttctgtcgccccgataaactgcgactccacatgctc
cggcattcggaccgcaaagacttcctgtgttccacctgtgggaagcaatttaagcgaaaa
gacaaactacgggaacacatgcagaggatgcataatcctgagagggaggccaagaaagcc
gaccgcatcagccgctccaagacgttcaagccccgcatcacgtccacagactacgacagc
ttcacgttcaagtgccgcctgtgcatgatgggcttccggcggcgcggcatgctggtaaat
cacttatcgaagagacacccagacatgaagatagaagaggtgccagagttaactctaccc
atcataaaacccaatcgtgattacttttgtcagtattgcgataaggtttataaaagtgcc
agcaagcgcaaagcccacattctgaagaaccacccaggagcagagctcccaccgagcatt
cggaagctccgacccgctggtcctggagagccagaccccatgctgagcacacacacccag
ctgacgggcaccatcgccacccctcccgtctgctgtccccactgctccaagcagtacagc
agcaagaccaagatggtccagcacattcgaaagaagcatccagagttcgcccagctctcc
aacaccatacacacaccactgacgacagctgtgatcagtgccaccccagcggttttgact
acagacagcgccactggagagactgtggtgacgacggacctgctcacccaagcaatgaca
gaactgtcccagaccttaacgacagactaccgaacgccacaaggggattaccagagaatt
cagtacatccctgtgtcgcagtcggcgtctggcctccagcagcctcagcacatacagctg
caagtggttcaagtggcctcggccacttcccctcaccagtcacagcagtccactgtggat
gttggccagctccatgatcctcagccctacccccagcacgccatccaggtgcagcacatc
caggtcagcgagcctaccgcctcggccccgtcctccgcccaggtatctgggcagccgttg
agtccctcagcccagcaggctcagcaggggctcagcccctcccacatccagggcagttct
tccacacaggggcaggctctgcagcagcagcagcagcagcagcagaattcctctgtgcag
cacacgtacctgcccagtgcttggaattccttccgtggctattcatctgagattcaaatg
atgacgcttcctccgggtcagtttgtgattacagacagtggtgtggcaactccagttact
actggccaggtgaaggcggttacttcgggtcattatgtgttatcagaaagtcaatcagaa
ttggaagaaaagcaaacttctgccctctctggtggagtccaggtcgagccacctgcacac
agtgactccctggacccccagaccaacagccaacagcagaccacacagtacatcatcacc
accaccaccaacgggaacggaagcagcgaagtgcatatcaccaaaccatga

DBGET integrated database retrieval system