KEGG   Homo sapiens (human): 56983Help
Entry
56983             CDS       T01001                                 

Gene name
POGLUT1, C3orf9, CLP46, KDELCL1, KTELC1, LGMD2Z, LGMDR21, MDS010, MDSRP, Rumi, hCLP46
Definition
(RefSeq) protein O-glucosyltransferase 1
  KO
K13667  protein glucosyltransferase [EC:2.4.1.-]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00514  Other types of O-glycan biosynthesis
Disease
H00593  Limb-girdle muscular dystrophy
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    56983 (POGLUT1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:hsa01003]
    56983 (POGLUT1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.-  
     56983 (POGLUT1)
Glycosyltransferases [BR:hsa01003]
 O-Glycan biosynthesis
  O-linked Glc type
   56983 (POGLUT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_transf_90 Glyco_trans_1_2
Motif
Other DBs
NCBI-GeneID: 56983
NCBI-ProteinID: NP_689518
OMIM: 615618
HGNC: 22954
Ensembl: ENSG00000163389
Vega: OTTHUMG00000159379
Pharos: Q8NBL1(Tbio)
UniProt: Q8NBL1
Structure
PDB: 

Position
3q13.33
AA seq 392 aa AA seqDB search
MEWWASSPLRLWLLLFLLPSAQGRQKESGSKWKVFIDQINRSLENYEPCSSQNCSCYHGV
IEEDLTPFRGGISRKMMAEVVRRKLGTHYQITKNRLYRENDCMFPSRCSGVEHFILEVIG
RLPDMEMVINVRDYPQVPKWMEPAIPVFSFSKTSEYHDIMYPAWTFWEGGPAVWPIYPTG
LGRWDLFREDLVRSAAQWPWKKKNSTAYFRGSRTSPERDPLILLSRKNPKLVDAEYTKNQ
AWKSMKDTLGKPAAKDVHLVDHCKYKYLFNFRGVAASFRFKHLFLCGSLVFHVGDEWLEF
FYPQLKPWVHYIPVKTDLSNVQELLQFVKANDDVAQEIAERGSQFIRNHLQMDDITCYWE
NLLSEYSKFLSYNVTRRKGYDQIIPKMLKTEL
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atggagtggtgggctagctcgccgcttcggctctggctgctgttgttcctcctgccctca
gcgcagggccgccagaaggagtcaggttcaaaatggaaagtatttattgaccaaattaac
aggtctttggagaattacgaaccatgttcaagtcaaaactgcagctgctaccatggtgtc
atagaagaggatctaactcctttccgaggaggcatctccaggaagatgatggcagaggta
gtcagacggaagctagggacccactatcagatcactaagaacagactgtaccgggaaaat
gactgcatgttcccctcaaggtgtagtggtgttgagcactttattttggaagtgatcggg
cgtctccctgacatggagatggtgatcaatgtacgagattatcctcaggttcctaaatgg
atggagcctgccatcccagtcttctccttcagtaagacatcagagtaccatgatatcatg
tatcctgcttggacattttgggaagggggacctgctgtttggccaatttatcctacaggt
cttggacggtgggacctcttcagagaagatctggtaaggtcagcagcacagtggccatgg
aaaaagaaaaactctacagcatatttccgaggatcaaggacaagtccagaacgagatcct
ctcattcttctgtctcggaaaaacccaaaacttgttgatgcagaatacaccaaaaaccag
gcctggaaatctatgaaagataccttaggaaagccagctgctaaggatgtccatcttgtg
gatcactgcaaatacaagtatctgtttaattttcgaggcgtagctgcaagtttccggttt
aaacacctcttcctgtgtggctcacttgttttccatgttggtgatgagtggctagaattc
ttctatccacagctgaagccatgggttcactatatcccagtcaaaacagatctctccaat
gtccaagagctgttacaatttgtaaaagcaaatgatgatgtagctcaagagattgctgaa
aggggaagccagtttattaggaaccatttgcagatggatgacatcacctgttactgggag
aacctcttgagtgaatactctaaattcctgtcttataatgtaacgagaaggaaaggttat
gatcaaattattcccaaaatgttgaaaactgaactatag

DBGET integrated database retrieval system