KEGG   Homo sapiens (human): 5699Help
Entry
5699              CDS       T01001                                 

Gene name
PSMB10, LMP10, MECL1, beta2i
Definition
(RefSeq) proteasome subunit beta 10
  KO
K02733  20S proteasome subunit beta 10 [EC:3.4.25.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa03050  Proteasome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    5699 (PSMB10)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    5699 (PSMB10)
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:hsa03051]
    5699 (PSMB10)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.25  Threonine endopeptidases
    3.4.25.1  proteasome endopeptidase complex
     5699 (PSMB10)
Peptidases and inhibitors [BR:hsa01002]
 Threonine peptidases
  Family T1: proteasome family
   5699 (PSMB10)
Proteasome [BR:hsa03051]
 Eukaryotic proteasome
  Core particles (20S proteasome)
   beta type subunits
    5699 (PSMB10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Proteasome Pr_beta_C DUF5331
Motif
Other DBs
NCBI-GeneID: 5699
NCBI-ProteinID: NP_002792
OMIM: 176847
HGNC: 9538
Ensembl: ENSG00000205220
Vega: OTTHUMG00000137553
Pharos: P40306(Tchem)
UniProt: P40306
Structure
PDB: 

Position
16q22.1
AA seq 273 aa AA seqDB search
MLKPALEPRGGFSFENCQRNASLERVLPGLKVPHARKTGTTIAGLVFQDGVILGADTRAT
NDSVVADKSCEKIHFIAPKIYCCGAGVAADAEMTTRMVASKMELHALSTGREPRVATVTR
ILRQTLFRYQGHVGASLIVGGVDLTGPQLYGVHPHGSYSRLPFTALGSGQDAALAVLEDR
FQPNMTLEAAQGLLVEAVTAGILGDLGSGGNVDACVITKTGAKLLRTLSSPTEPVKRSGR
YHFVPGTTAVLTQTVKPLTLELVEETVQAMEVE
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgctgaagccagccctggagccccgagggggcttctccttcgagaactgccaaagaaat
gcatcattggaacgcgtcctcccggggctcaaggtccctcacgcacgcaagaccgggacc
accatcgcgggcctggtgttccaagacggggtcattctgggcgccgatacgcgagccact
aacgattcggtcgtggcggacaagagctgcgagaagatccacttcatcgcccccaaaatc
tactgctgtggggctggagtagccgcggacgccgagatgaccacacggatggtggcgtcc
aagatggagctacacgcgttatctacgggccgcgagccccgcgtggccacggtcactcgc
atcctgcgccagacgctcttcaggtaccagggccacgtgggtgcatcgctgatcgtgggc
ggcgtagacctgactggaccgcagctctacggtgtgcatccccatggctcctacagccgt
ctgcccttcacagccctgggctctggtcaggacgcggccctggcggtgctagaagaccgg
ttccagccgaacatgacgctggaggctgctcaggggctgctggtggaagccgtcaccgcc
gggatcttgggtgacctgggctccgggggcaatgtggacgcatgtgtgatcacaaagact
ggcgccaagctgctgcggacactgagctcacccacagagcccgtgaagaggtctggccgc
taccactttgtgcctggaaccacagctgtcctgacccagacagtgaagccactaaccctg
gagctagtggaggaaactgtgcaggctatggaggtggagtaa

DBGET integrated database retrieval system