KEGG   Homo sapiens (human): 56993
Entry
56993             CDS       T01001                                 

Gene name
TOMM22, 1C9-2, MST065, MSTP065, TOM22
Definition
(RefSeq) translocase of outer mitochondrial membrane 22
  KO
K17769  mitochondrial import receptor subunit TOM22
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:hsa03029]
    56993 (TOMM22)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    56993 (TOMM22)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial protein import machinery
  Outer membrane
   Transporter outer membrane (TOM) complex
    56993 (TOMM22)
Transporters [BR:hsa02000]
 Other transporters
  Primary active transporters [TC:3]
   56993 (TOMM22)
SSDB
Motif
Pfam: Tom22
Other DBs
NCBI-GeneID: 56993
NCBI-ProteinID: NP_064628
OMIM: 607046
HGNC: 18002
Ensembl: ENSG00000100216
Vega: OTTHUMG00000150991
Pharos: Q9NS69(Tbio)
UniProt: Q9NS69 Q549C5
Position
22q13.1
AA seq 142 aa
MAAAVAAAGAGEPQSPDELLPKGDAEKPEEELEEDDDEELDETLSERLWGLTEMFPERVR
SAAGATFDLSLFVAQKMYRFSRAALWIGTTSFMILVLPVVFETEKLQMEQQQQLQQRQIL
LGPNTGLSGGMPGALPSLPGKI
NT seq 429 nt   +upstreamnt  +downstreamnt
atggctgccgccgtcgctgctgccggtgcaggggaaccccagtccccggacgaattgctc
ccgaaaggcgacgcggagaagcctgaggaggagctggaggaggacgacgatgaggagcta
gatgagaccctgtcggagagactatggggcctgacggagatgtttccggagagggtccgg
tccgcggccggagccacttttgatctttccctctttgtggctcagaaaatgtacaggttt
tccagggcagccttgtggattgggaccacttcctttatgatcctggttcttcccgttgtc
tttgagacggagaagttgcaaatggagcaacagcagcaactgcagcagcggcagatactt
ctaggacctaacacagggctctcaggaggaatgccaggggctctaccctcacttcctgga
aagatctag

DBGET integrated database retrieval system