KEGG   Homo sapiens (human): 57001
Entry
57001             CDS       T01001                                 

Gene name
SDHAF3, ACN9, DC11, LYRM10, Sdh7
Definition
(RefSeq) succinate dehydrogenase complex assembly factor 3
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: Complex1_LYR_2 Complex1_LYR DUF4028
Other DBs
NCBI-GeneID: 57001
NCBI-ProteinID: NP_064571
OMIM: 615773
HGNC: 21752
Ensembl: ENSG00000196636
Vega: OTTHUMG00000154064
Pharos: Q9NRP4(Tbio)
UniProt: Q9NRP4
Position
7q21.3
AA seq 125 aa
MPGRHVSRVRALYKRVLQLHRVLPPDLKSLGDQYVKDEFRRHKTVGSDEAQRFLQEWEVY
ATALLQQANENRQNSTGKACFGTFLPEEKLNDFRDEQIGQLQELMQEATKPNRQFSISES
MKPKF
NT seq 378 nt   +upstreamnt  +downstreamnt
atgccggggcggcacgtttctcgagtccgggcattgtacaagcgcgtcttgcagctgcac
cgtgttctgcccccggacctcaaatccctgggcgaccagtacgtgaaagacgaatttagg
agacataagaccgttggttctgacgaggcacagcgtttcttgcaagaatgggaggtgtat
gcaacagcgttattgcaacaggctaacgaaaacagacaaaattcaactggaaaagcatgt
tttggcaccttcctcccagaagaaaaacttaatgactttcgtgatgaacaaattggacag
ttgcaggagctgatgcaagaagccacaaaacccaataggcaatttagtatttctgagtct
atgaaaccaaaattttag

DBGET integrated database retrieval system