KEGG   Homo sapiens (human): 57003Help
Entry
57003             CDS       T01001                                 

Gene name
CCDC47, GK001, MSTP041, THNS
Definition
(RefSeq) coiled-coil domain containing 47
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: DUF1682
Motif
Other DBs
NCBI-GeneID: 57003
NCBI-ProteinID: NP_064583
OMIM: 618260
HGNC: 24856
Ensembl: ENSG00000108588
Vega: OTTHUMG00000178933
Pharos: Q96A33(Tbio)
UniProt: Q96A33
Position
17q23.3
AA seq 483 aa AA seqDB search
MKAFHTFCVVLLVFGSVSEAKFDDFEDEEDIVEYDDNDFAEFEDVMEDSVTESPQRVIIT
EDDEDETTVELEGQDENQEGDFEDADTQEGDTESEPYDDEEFEGYEDKPDTSSSKNKDPI
TIVDVPAHLQNSWESYYLEILMVTGLLAYIMNYIIGKNKNSRLAQAWFNTHRELLESNFT
LVGDDGTNKEATSTGKLNQENEHIYNLWCSGRVCCEGMLIQLRFLKRQDLLNVLARMMRP
VSDQVQIKVTMNDEDMDTYVFAVGTRKALVRLQKEMQDLSEFCSDKPKSGAKYGLPDSLA
ILSEMGEVTDGMMDTKMVHFLTHYADKIESVHFSDQFSGPKIMQEEGQPLKLPDTKRTLL
FTFNVPGSGNTYPKDMEALLPLMNMVIYSIDKAKKFRLNREGKQKADKNRARVEENFLKL
THVQRQEAAQSRREEKKRAEKERIMNEEDPEKQRRLEEAALRREQKKLEKKQMKMKQIKV
KAM
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgaaagccttccacactttctgtgttgtccttctggtgtttgggagtgtctctgaagcc
aagtttgatgattttgaggatgaggaggacatagtagagtatgatgataatgacttcgct
gaatttgaggatgtcatggaagactctgttactgaatctcctcaacgggtcataatcact
gaagatgatgaagatgagaccactgtggagttggaagggcaggatgaaaaccaagaagga
gattttgaagatgcagatacccaggagggagatactgagagtgaaccatatgatgatgaa
gaatttgaaggttatgaagacaaaccagatacttcttctagcaaaaataaagacccaata
acgattgttgatgttcctgcacacctccagaacagctgggagagttattatctagaaatt
ttgatggtgactggtctgcttgcttatatcatgaattacatcattgggaagaataaaaac
agtcgccttgcacaggcctggtttaacactcatagggagcttttggagagcaactttact
ttagtgggggatgatggaactaacaaagaagccacaagcacaggaaagttgaaccaggag
aatgagcacatctataacctgtggtgttctggtcgagtgtgctgtgagggcatgcttatc
cagctgaggttcctcaagagacaagacttactgaatgtcctggcccggatgatgaggcca
gtgagtgatcaagtgcaaataaaagtaaccatgaatgatgaagacatggatacctacgta
tttgctgttggcacacggaaagccttggtgcgactacagaaagagatgcaggatttgagt
gagttttgtagtgataaacctaagtctggagcaaagtatggactgccggactctttggcc
atcctgtcagagatgggagaagtcacagacggaatgatggatacaaagatggttcacttt
cttacacactatgctgacaagattgaatctgttcatttttcagaccagttctctggtcca
aaaattatgcaagaggaaggtcagcctttaaagctacctgacactaagaggacactgttg
tttacatttaatgtgcctggctcaggtaacacttacccaaaggatatggaggcactgcta
cccctgatgaacatggtgatttattctattgataaagccaaaaagttccgactcaacaga
gaaggcaaacaaaaagcagataagaaccgtgcccgagtagaagagaacttcttgaaactg
acacatgtgcaaagacaggaagcagcacagtctcggcgggaggagaaaaaaagagcagag
aaggagcgaatcatgaatgaggaagatcctgagaaacagcgcaggctggaggaggctgca
ttgaggcgtgagcaaaagaagttggaaaagaagcaaatgaaaatgaaacaaatcaaagtg
aaagccatgtaa

DBGET integrated database retrieval system