KEGG   Homo sapiens (human): 57007Help
Entry
57007             CDS       T01001                                 

Gene name
ACKR3, CMKOR1, CXC-R7, CXCR-7, CXCR7, GPR159, RDC-1, RDC1
Definition
(RefSeq) atypical chemokine receptor 3
  KO
K04304  C-X-C chemokine receptor type 7 (atypical chemokine receptor 3)
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    57007 (ACKR3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    57007 (ACKR3)
   04050 Cytokine receptors [BR:hsa04050]
    57007 (ACKR3)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Chemokine
   CXC Chemokine
    57007 (ACKR3)
Cytokine receptors [BR:hsa04050]
 Chemokine receptors
  CXC Chemokine
   57007 (ACKR3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1
Motif
Other DBs
NCBI-GeneID: 57007
NCBI-ProteinID: NP_064707
OMIM: 610376
HGNC: 23692
Ensembl: ENSG00000144476
Vega: OTTHUMG00000133295
Pharos: P25106(Tchem)
UniProt: P25106
Position
2q37.3
AA seq 362 aa AA seqDB search
MDLHLFDYSEPGNFSDISWPCNSSDCIVVDTVMCPNMPNKSVLLYTLSFIYIFIFVIGMI
ANSVVVWVNIQAKTTGYDTHCYILNLAIADLWVVLTIPVWVVSLVQHNQWPMGELTCKVT
HLIFSINLFGSIFFLTCMSVDRYLSITYFTNTPSSRKKMVRRVVCILVWLLAFCVSLPDT
YYLKTVTSASNNETYCRSFYPEHSIKEWLIGMELVSVVLGFAVPFSIIAVFYFLLARAIS
ASSDQEKHSSRKIIFSYVVVFLVCWLPYHVAVLLDIFSILHYIPFTCRLEHALFTALHVT
QCLSLVHCCVNPVLYSFINRNYRYELMKAFIFKYSAKTGLTKLIDASRVSETEYSALEQS
TK
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atggatctgcatctcttcgactactcagagccagggaacttctcggacatcagctggcca
tgcaacagcagcgactgcatcgtggtggacacggtgatgtgtcccaacatgcccaacaaa
agcgtcctgctctacacgctctccttcatttacattttcatcttcgtcatcggcatgatt
gccaactccgtggtggtctgggtgaatatccaggccaagaccacaggctatgacacgcac
tgctacatcttgaacctggccattgccgacctgtgggttgtcctcaccatcccagtctgg
gtggtcagtctcgtgcagcacaaccagtggcccatgggcgagctcacgtgcaaagtcaca
cacctcatcttctccatcaacctcttcggcagcattttcttcctcacgtgcatgagcgtg
gaccgctacctctccatcacctacttcaccaacacccccagcagcaggaagaagatggta
cgccgtgtcgtctgcatcctggtgtggctgctggccttctgcgtgtctctgcctgacacc
tactacctgaagaccgtcacgtctgcgtccaacaatgagacctactgccggtccttctac
cccgagcacagcatcaaggagtggctgatcggcatggagctggtctccgttgtcttgggc
tttgccgttcccttctccattatcgctgtcttctacttcctgctggccagagccatctcg
gcgtccagtgaccaggagaagcacagcagccggaagatcatcttctcctacgtggtggtc
ttccttgtctgctggctgccctaccacgtggcggtgctgctggacatcttctccatcctg
cactacatccctttcacctgccggctggagcacgccctcttcacggccctgcatgtcaca
cagtgcctgtcgctggtgcactgctgcgtcaaccctgtcctctacagcttcatcaatcgc
aactacaggtacgagctgatgaaggccttcatcttcaagtactcggccaaaacagggctc
accaagctcatcgatgcctccagagtctcagagacggagtactctgccttggagcagagc
accaaatga

DBGET integrated database retrieval system