KEGG   Homo sapiens (human): 5701
Entry
5701              CDS       T01001                                 

Gene name
PSMC2, MSS1, Nbla10058, S7
Definition
(RefSeq) proteasome 26S subunit, ATPase 2
  KO
K03061  26S proteasome regulatory subunit T1
Organism
hsa  Homo sapiens (human)
Pathway
hsa03050  Proteasome
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05017  Spinocerebellar ataxia
hsa05020  Prion disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05169  Epstein-Barr virus infection
Network
nt06420  Ubiquitin-proteasome system
nt06460  Alzheimer disease
nt06461  Huntington disease
nt06463  Parkinson disease
nt06464  Amyotrophic lateral sclerosis
nt06465  Prion disease
  Element
N01029  26S proteasome-mediated protein degradation
N01030  Mutation-caused aberrant SNCA to 26S proteasome-mediated protein degradation
N01060  Mutation-caused aberrant Abeta to 26S proteasome-mediated protein degradation
N01061  Mutation-caused aberrant Htt to 26S proteasome-mediated protein degradation
N01144  Mutation-caused aberrant SOD1 to 26S proteasome-mediated protein degradation
N01145  Mutation-inactivated VCP to 26S proteasome-mediated protein degradation
N01146  Mutation-inactivated UBQLN2 to 26S proteasome-mediated protein degradation
N01197  Scrapie conformation PrPSc to 26S proteasome-mediated protein degradation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    5701 (PSMC2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    5701 (PSMC2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    5701 (PSMC2)
   05012 Parkinson disease
    5701 (PSMC2)
   05014 Amyotrophic lateral sclerosis
    5701 (PSMC2)
   05016 Huntington disease
    5701 (PSMC2)
   05017 Spinocerebellar ataxia
    5701 (PSMC2)
   05020 Prion disease
    5701 (PSMC2)
   05022 Pathways of neurodegeneration - multiple diseases
    5701 (PSMC2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:hsa03051]
    5701 (PSMC2)
Proteasome [BR:hsa03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    ATPase subunits
     5701 (PSMC2)
SSDB
Motif
Pfam: AAA AAA_lid_3 AAA_22 AAA_5 AAA_16 AAA_2 DUF815 RuvB_N AAA_18 AAA_7 AAA_28 AAA_33 Sigma54_activ_2 Mg_chelatase AAA_14 TIP49 IstB_IS21 AAA_24 Prot_ATP_ID_OB RNA_helicase HMW1C_N T2SSE AAA_3 Sigma54_activat
Other DBs
NCBI-GeneID: 5701
NCBI-ProteinID: NP_002794
OMIM: 154365
HGNC: 9548
Ensembl: ENSG00000161057
Vega: OTTHUMG00000157206
Pharos: P35998(Tbio)
UniProt: P35998 A0A140VK70
Structure
PDB: 

Position
7q22.1
AA seq 433 aa
MPDYLGADQRKTKEDEKDDKPIRALDEGDIALLKTYGQSTYSRQIKQVEDDIQQLLKKIN
ELTGIKESDTGLAPPALWDLAADKQTLQSEQPLQVARCTKIINADSEDPKYIINVKQFAK
FVVDLSDQVAPTDIEEGMRVGVDRNKYQIHIPLPPKIDPTVTMMQVEEKPDVTYSDVGGC
KEQIEKLREVVETPLLHPERFVNLGIEPPKGVLLFGPPGTGKTLCARAVANRTDACFIRV
IGSELVQKYVGEGARMVRELFEMARTKKACLIFFDEIDAIGGARFDDGAGGDNEVQRTML
ELINQLDGFDPRGNIKVLMATNRPDTLDPALMRPGRLDRKIEFSLPDLEGRTHIFKIHAR
SMSVERDIRFELLARLCPNSTGAEIRSVCTEAGMFAIRARRKIATEKDFLEAVNKVIKSY
AKFSATPRYMTYN
NT seq 1302 nt   +upstreamnt  +downstreamnt
atgccggattacctcggtgccgatcagcggaagaccaaagaggatgagaaggacgacaag
cccatccgagctctggatgagggggatattgccttgttgaaaacttatggtcagagcact
tactctaggcagatcaagcaagttgaagatgacattcagcaacttctcaagaaaattaat
gagctcactggtattaaagaatctgacactggcctggccccaccagcactctgggatttg
gctgcagataagcagacactccagagtgaacagcctttacaggttgccaggtgtacaaag
ataatcaatgctgattcggaggacccaaaatacattatcaacgtaaagcagtttgccaag
tttgtggtggaccttagtgatcaggtggcacctactgacattgaagaagggatgagagtg
ggcgtggatagaaataaatatcaaattcacattccattgcctcctaagattgacccaaca
gttaccatgatgcaggtggaagagaaacctgatgtcacatacagtgatgttggtggctgt
aaggaacagattgagaaactgcgagaagtagttgaaaccccattacttcatccagagagg
tttgtgaaccttggcattgagcctcccaagggcgtgctgctctttggtccacccggtaca
ggcaagacactctgtgcgcgggcagttgctaatcggactgatgcgtgcttcattcgagtt
attggatctgagcttgtacagaaatacgtcggtgagggggctcgaatggttcgtgaactc
tttgaaatggccagaacaaaaaaagcctgccttatcttctttgatgaaattgatgctatt
ggaggggctcgttttgatgatggtgctggaggtgacaatgaagtgcagagaacaatgttg
gaactgatcaatcagcttgatggttttgatcctagaggcaatattaaagtgctgatggcc
actaacagacctgatactttggatccagcactgatgaggccagggagattggatagaaaa
attgaatttagcttgcccgatctagagggtcggacccacatatttaagattcacgctcgt
tcaatgagtgttgaaagagatatcagatttgaactgttagcacgactgtgtccaaatagc
actggtgctgagattagaagcgtctgcacagaggctggtatgtttgccatcagagcacgg
cgaaaaattgctaccgagaaggatttcttggaagctgtaaataaggtcattaagtcttat
gccaaattcagtgctactcctcgttacatgacatacaactga

DBGET integrated database retrieval system