KEGG   Homo sapiens (human): 5702Help
Entry
5702              CDS       T01001                                 

Gene name
PSMC3, TBP1
Definition
(RefSeq) proteasome 26S subunit, ATPase 3
  KO
K03065  26S proteasome regulatory subunit T5
Organism
hsa  Homo sapiens (human)
Pathway
hsa03050  Proteasome
hsa05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    5702 (PSMC3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    5702 (PSMC3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:hsa03051]
    5702 (PSMC3)
Proteasome [BR:hsa03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    ATPase subunits
     5702 (PSMC3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AAA Prot_ATP_ID_OB AAA_lid_3 AAA_5 AAA_16 RuvB_N AAA_2 AAA_22 AAA_33 DUF815 PhoH Mg_chelatase AAA_11 Sigma54_activat IstB_IS21 JIP_LZII ATPase AAA_24 DUF3713 AAA_7 RNA_helicase
Motif
Other DBs
NCBI-GeneID: 5702
NCBI-ProteinID: NP_002795
OMIM: 186852
HGNC: 9549
Ensembl: ENSG00000165916
Vega: OTTHUMG00000167692
Pharos: P17980(Tbio)
UniProt: P17980 A0A140VK42
Structure
PDB: 

Position
11p11.2
AA seq 439 aa AA seqDB search
MNLLPNIESPVTRQEKMATVWDEAEQDGIGEEVLKMSTEEIIQRTRLLDSEIKIMKSEVL
RVTHELQAMKDKIKENSEKIKVNKTLPYLVSNVIELLDVDPNDQEEDGANIDLDSQRKGK
CAVIKTSTRQTYFLPVIGLVDAEKLKPGDLVGVNKDSYLILETLPTEYDSRVKAMEVDER
PTEQYSDIGGLDKQIQELVEAIVLPMNHKEKFENLGIQPPKGVLMYGPPGTGKTLLARAC
AAQTKATFLKLAGPQLVQMFIGDGAKLVRDAFALAKEKAPSIIFIDELDAIGTKRFDSEK
AGDREVQRTMLELLNQLDGFQPNTQVKVIAATNRVDILDPALLRSGRLDRKIEFPMPNEE
ARARIMQIHSRKMNVSPDVNYEELARCTDDFNGAQCKAVCVEAGMIALRRGATELTHEDY
MEGILEVQAKKKANLQYYA
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgaatctgctgccgaatattgagagtccagtgactcggcaggagaagatggcgaccgtg
tgggatgaggccgagcaagatggaattggggaggaggtgctcaagatgtccacggaggag
atcatccagcgcacacggctgctggacagtgagatcaagatcatgaagagtgaagtgttg
agagtcacccatgagctccaagccatgaaggacaagataaaagagaacagtgagaaaatc
aaagtgaacaagaccctgccgtaccttgtctccaacgtcatcgagctcctggatgttgat
cctaatgaccaagaggaggatggtgccaatattgacctggactcccagaggaagggcaag
tgtgctgtgatcaaaacctctacacgacagacgtacttccttcctgtgattgggttggtg
gatgctgaaaagctaaagccaggagacctggtgggtgtgaacaaagactcctatctgatc
ctggagacgctgcccacagagtatgactcgcgggtgaaggccatggaggtagacgagagg
cccacggagcaatacagtgacattgggggtttggacaagcagatccaggagctggtggag
gccattgtcttgccaatgaaccacaaggagaagtttgagaacttggggatccaacctcca
aaaggggtgctgatgtatgggcccccagggacggggaagaccctcctggcccgggcctgt
gccgcacagactaaggccaccttcctaaagctggctggcccccagctggtgcagatgttc
attggagatggtgccaagctagtccgggatgcctttgccctggccaaggagaaagcgccc
tctatcatcttcattgatgagttggatgccatcggcaccaagcgctttgacagtgagaag
gctggggaccgggaggtgcagaggacaatgctggagcttctgaaccagctggatggcttc
cagcccaacacccaagttaaggtaattgcagccacaaacagggtggacatcctggacccc
gccctcctccgctcgggccgccttgaccgcaagatagagttcccgatgcccaatgaggag
gcccgggccagaatcatgcagatccactcccgaaagatgaatgtcagtcctgacgtgaac
tacgaggagctggcccgctgcacagatgacttcaatggggcccagtgcaaggctgtgtgt
gtggaggcgggcatgatcgcactgcgcaggggtgccacggagctcacccacgaggactac
atggaaggcatcctggaggtgcaggccaagaagaaagccaacctacaatactacgcctag

DBGET integrated database retrieval system