KEGG   Homo sapiens (human): 57030Help
Entry
57030             CDS       T01001                                 

Gene name
SLC17A7, BNPI, VGLUT1
Definition
(RefSeq) solute carrier family 17 member 7
  KO
K12302  MFS transporter, ACS family, solute carrier family 17 (sodium-dependent inorganic phosphate cotransporter), member 6/7/8
Organism
hsa  Homo sapiens (human)
Pathway
hsa04721  Synaptic vesicle cycle
hsa04723  Retrograde endocannabinoid signaling
hsa04724  Glutamatergic synapse
hsa05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    57030 (SLC17A7)
   04723 Retrograde endocannabinoid signaling
    57030 (SLC17A7)
   04721 Synaptic vesicle cycle
    57030 (SLC17A7)
 09160 Human Diseases
  09165 Substance dependence
   05033 Nicotine addiction
    57030 (SLC17A7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    57030 (SLC17A7)
Transporters [BR:hsa02000]
 Solute Carrier Family (SLC)
  SLC17: Vesicular glutamate transporter
   57030 (SLC17A7)
 Major Facilitator Superfamily (MFS)
  Organic acid transporters
   Anion:cation symporter (ACS) family [TC:2.A.1.14]
    57030 (SLC17A7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MFS_1
Motif
Other DBs
NCBI-GeneID: 57030
NCBI-ProteinID: NP_064705
OMIM: 605208
HGNC: 16704
Ensembl: ENSG00000104888
Vega: OTTHUMG00000183166
Pharos: Q9P2U7(Tbio)
UniProt: Q9P2U7
Position
19q13.33
AA seq 560 aa AA seqDB search
MEFRQEEFRKLAGRALGKLHRLLEKRQEGAETLELSADGRPVTTQTRDPPVVDCTCFGLP
RRYIIAIMSGLGFCISFGIRCNLGVAIVSMVNNSTTHRGGHVVVQKAQFSWDPETVGLIH
GSFFWGYIVTQIPGGFICQKFAANRVFGFAIVATSTLNMLIPSAARVHYGCVIFVRILQG
LVEGVTYPACHGIWSKWAPPLERSRLATTAFCGSYAGAVVAMPLAGVLVQYSGWSSVFYV
YGSFGIFWYLFWLLVSYESPALHPSISEEERKYIEDAIGESAKLMNPLTKFSTPWRRFFT
SMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGLVSALPHLVMTIIVPIGGQ
IADFLRSRRIMSTTNVRKLMNCGGFGMEATLLLVVGYSHSKGVAISFLVLAVGFSGFAIS
GFNVNHLDIAPRYASILMGISNGVGTLSGMVCPIIVGAMTKHKTREEWQYVFLIASLVHY
GGVIFYGVFASGEKQPWAEPEEMSEEKCGFVGHDQLAGSDDSEMEDEAEPPGAPPAPPPS
YGATHSTFQPPRPPPPVRDY
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
atggagttccgccaggaggagtttcggaagctagcgggtcgtgctctcgggaagctgcac
cgccttctggagaagcggcaggaaggcgcggagacgctggagctgagtgcggatgggcgc
ccggtgaccacgcagacccgggacccgccggtggtggactgcacctgcttcggcctccct
cgccgctacattatcgccatcatgagtggtctgggcttctgcatcagctttggcatccgc
tgcaacctgggcgtggccatcgtctccatggtcaataacagcacgacccaccgcgggggc
cacgtggtggtgcagaaagcccagttcagctgggatccagagactgtcggcctcatacac
ggctcctttttctggggctacattgtcactcagattccaggaggatttatctgtcaaaaa
tttgcagccaacagagttttcggctttgctattgtggcaacatccactctaaacatgctg
atcccctcagctgcccgcgtccactatggctgtgtcatcttcgtgaggatcctgcagggg
ttggtagagggggtcacataccccgcctgccatgggatctggagcaaatgggccccaccc
ttagaacggagtcgcctggcgacgacagccttttgtggttcctatgctggggcggtggtc
gcgatgcccctcgccggggtccttgtgcagtactcaggatggagctctgttttctacgtc
tacggcagcttcgggatcttctggtacctgttctggctgctcgtctcctacgagtccccc
gcgctgcaccccagcatctcggaggaggagcgcaagtacatcgaggacgccatcggagag
agcgcgaaactcatgaaccccctcacgaagtttagcactccctggcggcgcttcttcacg
tctatgccagtctatgccatcatcgtggccaacttctgccgcagctggacgttctacctg
ctgctcatctcccagcccgcctacttcgaagaagtgttcggcttcgagatcagcaaggta
ggcctggtgtccgcgctgccccacctggtcatgaccatcatcgtgcccatcggcggccag
atcgcggacttcctgcggagccgccgcatcatgtccaccaccaacgtgcgcaagttgatg
aactgcggaggcttcggcatggaagccacgctgctgttggtggtcggctactcgcactcc
aagggcgtggccatctccttcctggtcctagccgtgggcttcagcggcttcgccatctct
gggttcaacgtgaaccacctggacatagccccgcgctacgccagcatcctcatgggcatc
tccaacggcgtgggcacactgtcgggcatggtgtgccccatcatcgtgggggccatgact
aagcacaagactcgggaggagtggcagtacgtgttcctaattgcctccctggtgcactat
ggaggtgtcatcttctacggggtctttgcttctggagagaagcagccgtgggcagagcct
gaggagatgagcgaggagaagtgtggcttcgttggccatgaccagctggctggcagtgac
gacagcgaaatggaggatgaggctgagcccccgggggcaccccctgcacccccgccctcc
tatggggccacacacagcacatttcagccccccaggcccccaccccctgtccgggactac
tga

DBGET integrated database retrieval system