KEGG   Homo sapiens (human): 57038
Entry
57038             CDS       T01001                                 

Gene name
RARS2, ArgRS, DALRD2, PCH6, PRO1992, RARSL
Definition
(RefSeq) arginyl-tRNA synthetase 2, mitochondrial
  KO
K01887  arginyl-tRNA synthetase [EC:6.1.1.19]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00970  Aminoacyl-tRNA biosynthesis
Disease
H00897  Pontocerebellar hypoplasia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    57038 (RARS2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:hsa01007]
    57038 (RARS2)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:hsa03016]
    57038 (RARS2)
   03029 Mitochondrial biogenesis [BR:hsa03029]
    57038 (RARS2)
Enzymes [BR:hsa01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.19  arginine---tRNA ligase
     57038 (RARS2)
Amino acid related enzymes [BR:hsa01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   57038 (RARS2)
Transfer RNA biogenesis [BR:hsa03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    57038 (RARS2)
 Prokaryotic type
   Other AARSs
    57038 (RARS2)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    57038 (RARS2)
SSDB
Motif
Pfam: tRNA-synt_1d DALR_1 DALR_2
Other DBs
NCBI-GeneID: 57038
NCBI-ProteinID: NP_064716
OMIM: 611524
HGNC: 21406
Ensembl: ENSG00000146282
Vega: OTTHUMG00000015178
Pharos: Q5T160(Tbio)
UniProt: Q5T160
Position
6q15
AA seq 578 aa
MACGFRRAIACQLSRVLNLPPENLITSISAVPISQKEEVADFQLSVDSLLEKDNDHSRPD
IQVQAKRLAEKLRCDTVVSEISTGQRTVNFKINRELLTKTVLQQVIEDGSKYGLKSELFS
GLPQKKIVVEFSSPNVAKKFHVGHLRSTIIGNFIANLKEALGHQVIRINYLGDWGMQFGL
LGTGFQLFGYEEKLQSNPLQHLFEVYVQVNKEAADDKSVAKAAQEFFQRLELGDVQALSL
WQKFRDLSIEEYIRVYKRLGVYFDEYSGESFYREKSQEVLKLLESKGLLLKTIKGTAVVD
LSGNGDPSSICTVMRSDGTSLYATRDLAAAIDRMDKYNFDTMIYVTDKGQKKHFQQVFQM
LKIMGYDWAERCQHVPFGVVQGMKTRRGDVTFLEDVLNEIQLRMLQNMASIKTTKELKNP
QETAERVGLAALIIQDFKGLLLSDYKFSWDRVFQSRGDTGVFLQYTHARLHSLEETFGCG
YLNDFNTACLQEPQSVSILQHLLRFDEVLYKSSQDFQPRHIVSYLLTLSHLAAVAHKTLQ
IKDSPPEVAGARLHLFKAVRSVLANGMKLLGITPVCRM
NT seq 1737 nt   +upstreamnt  +downstreamnt
atggcgtgcggctttcgccgcgctattgcttgccagctttccagagtgttgaatcttcca
ccagaaaacttgatcacatcaatatctgcagttccaatttcccaaaaagaagaagtagct
gattttcagctttctgtggattctttattggaaaaagacaatgaccattcaagaccagat
attcaagttcaagccaagagactagcagagaagctaagatgtgatacagtggtgagtgaa
atcagtactggtcaaaggactgtaaatttcaaaataaacagagagctcttaacaaagaca
gtgctacaacaagtaattgaagatggctcaaaatatggattaaaaagtgaacttttctct
ggacttccccagaagaagattgtggttgaattcagttcacctaatgttgccaaaaaattt
catgttggacatttgcgttctaccatcataggaaattttatagcaaatctcaaagaagct
ttaggacatcaagtaataagaataaattaccttggcgattggggcatgcagtttggtctt
ctgggaactggcttccagctgtttggctatgaggaaaaactgcagtccaatcctctacag
catctctttgaagtttatgtacaagttaataaagaagcagcagatgataaaagtgtagca
aaagcagcacaggagttcttccaacgattggaactgggcgatgtgcaagcactttcactg
tggcaaaaatttcgggacttgagcattgaagagtacattcgggtttacaagcgtctggga
gtatattttgatgaatattcaggagaatcattttatcgtgaaaaatctcaagaggtctta
aagttgctggagagtaaaggactcctactgaaaacaataaaaggaacggctgtagtagat
ctctctgggaatggcgacccctcctcaatttgtactgtaatgcgaagtgatgggacttct
ctctatgcaaccagagatcttgcagctgctatagatcgaatggacaagtataattttgat
acaatgatatatgtgacagataaaggacaaaaaaagcattttcagcaagtattccaaatg
ctgaagatcatgggatatgactgggcagaaaggtgccagcacgtgccctttggagtagta
cagggaatgaagactcgaagaggagatgtcactttcctggaagatgttttaaatgagatt
caattaaggatgctacagaacatggcttcaattaagacaactaaagaactcaagaaccca
caagagactgcagagagggtcgggctcgcagcactcattattcaggacttcaaaggttta
ctcttatctgactacaagttcagctgggatcgtgttttccagagtcgcggggacacagga
gtcttcctacagtacacacacgcccgcctccacagtttggaagagacttttggatgtggg
tacctgaatgacttcaacactgcttgtttacaagagccacagtctgtttcaattcttcag
catcttctcaggttcgacgaggtgctttataaatcatctcaggactttcaacccaggcat
atcgtcagttaccttctaactttaagtcatcttgcagctgtggcacacaaaacactacaa
ataaaagatagtcctcctgaagtggctggggccagacttcatcttttcaaagctgtccgt
tctgtcctagccaatggaatgaaacttcttggaataacacctgtatgtaggatgtaa

DBGET integrated database retrieval system