KEGG   Homo sapiens (human): 5704Help
Entry
5704              CDS       T01001                                 

Gene name
PSMC4, MIP224, RPT3, S6, TBP-7, TBP7
Definition
(RefSeq) proteasome 26S subunit, ATPase 4
  KO
K03063  26S proteasome regulatory subunit T3
Organism
hsa  Homo sapiens (human)
Pathway
hsa03050  Proteasome
hsa05169  Epstein-Barr virus infection
Module
hsa_M00341  Proteasome, 19S regulatory particle (PA700)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    5704 (PSMC4)
 09160 Human Diseases
  09172 Infectious diseases: Viral
   05169 Epstein-Barr virus infection
    5704 (PSMC4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:hsa03051]
    5704 (PSMC4)
Proteasome [BR:hsa03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    ATPase subunits
     5704 (PSMC4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AAA Prot_ATP_ID_OB AAA_lid_3 AAA_2 AAA_5 AAA_16 RuvB_N DUF815 AAA_22 RNA_helicase NTPase_1 Mg_chelatase AAA_14 AAA_28 AAA_18 IstB_IS21 AAA_33 Sigma54_activat NACHT TIP49 CENP-F_leu_zip AAA_3 TsaE ATPase_2 AAA_7 AAA_24 AAA_25 DUF3450 Zeta_toxin NB-ARC Parvo_NS1 AAA_17 ABC_tran DivIVA AAA_30
Motif
Other DBs
NCBI-GeneID: 5704
NCBI-ProteinID: NP_006494
OMIM: 602707
HGNC: 9551
Ensembl: ENSG00000013275
Vega: OTTHUMG00000182577
Pharos: P43686(Tbio)
UniProt: P43686 A8K2M0
Structure
PDB: 

Position
19q13.2
AA seq 418 aa AA seqDB search
MEEIGILVEKAQDEIPALSVSRPQTGLSFLGPEPEDLEDLYSRYKKLQQELEFLEVQEEY
IKDEQKNLKKEFLHAQEEVKRIQSIPLVIGQFLEAVDQNTAIVGSTTGSNYYVRILSTID
RELLKPNASVALHKHSNALVDVLPPEADSSIMMLTSDQKPDVMYADIGGMDIQKQEVREA
VELPLTHFELYKQIGIDPPRGVLMYGPPGCGKTMLAKAVAHHTTAAFIRVVGSEFVQKYL
GEGPRMVRDVFRLAKENAPAIIFIDEIDAIATKRFDAQTGADREVQRILLELLNQMDGFD
QNVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLIFSTITSKMNLSEEVDL
EDYVARPDKISGADINSICQESGMLAVRENRYIVLAKDFEKAYKTVIKKDEQEHEFYK
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atggaggagataggcatcttggtggagaaggctcaggatgagatcccagcactgtccgtg
tcccggccccagaccggcctgtccttcctgggccctgagcctgaggacctggaggacctg
tacagccgctacaagaagctgcagcaagagctggagttcctggaggtgcaggaggaatac
atcaaagatgagcaaaagaacctgaaaaaggaatttctccatgcccaggaggaggtgaag
cgaatccaaagcatcccgctggtcatcggacaatttctggaggctgtggatcagaataca
gccatcgtgggctctaccacaggctccaactattatgtgcgcatcctgagcaccatcgat
cgggagctgctcaagcccaacgcctcagtggccctccacaagcacagcaatgcactggtg
gacgtgctgccccccgaagccgacagcagcatcatgatgctcacctcagaccagaagcca
gatgtgatgtacgcggacatcggaggcatggacatccagaagcaggaggtgcgggaggcc
gtggagctcccgctcacgcatttcgagctctacaagcagatcggcatcgatcccccccga
ggcgtcctcatgtatggcccacctggctgtgggaagaccatgttggcaaaggcggtggca
catcacacaacagctgcattcatccgggtcgtgggctcggagtttgtacagaagtatctg
ggtgagggcccccgcatggtccgggatgtgttccgcctggccaaggagaatgcacctgcc
atcatcttcatagacgagattgatgccatcgccaccaagagattcgatgctcagacaggg
gccgacagggaggttcagaggatcctgctggagctgctgaatcagatggatggatttgat
cagaatgtcaatgtcaaggtaatcatggccacaaacagagcagacaccctggatccggcc
ctgctacggccaggacggctggaccgtaaaattgaatttccacttcctgaccgccgccag
aagagattgattttctccactatcactagcaagatgaacctctctgaggaggttgacttg
gaagactatgtggcccggccagataagatttcaggagctgatattaactccatctgtcag
gagagtggaatgttggctgtccgtgaaaaccgctacattgtcctggccaaggacttcgag
aaagcatacaagactgtcatcaagaaggacgagcaggagcatgagttttacaagtga

DBGET integrated database retrieval system