KEGG   Homo sapiens (human): 5705
Entry
5705              CDS       T01001                                 

Gene name
PSMC5, RPT6, S8, SUG-1, SUG1, TBP10, TRIP1, p45, p45/SUG
Definition
(RefSeq) proteasome 26S subunit, ATPase 5
  KO
K03066  26S proteasome regulatory subunit T6
Organism
hsa  Homo sapiens (human)
Pathway
hsa03050  Proteasome
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05017  Spinocerebellar ataxia
hsa05020  Prion disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05169  Epstein-Barr virus infection
Network
nt06420  Ubiquitin-proteasome system
nt06460  Alzheimer disease
nt06461  Huntington disease
nt06463  Parkinson disease
nt06464  Amyotrophic lateral sclerosis
nt06465  Prion disease
  Element
N01029  26S proteasome-mediated protein degradation
N01030  Mutation-caused aberrant SNCA to 26S proteasome-mediated protein degradation
N01060  Mutation-caused aberrant Abeta to 26S proteasome-mediated protein degradation
N01061  Mutation-caused aberrant Htt to 26S proteasome-mediated protein degradation
N01144  Mutation-caused aberrant SOD1 to 26S proteasome-mediated protein degradation
N01145  Mutation-inactivated VCP to 26S proteasome-mediated protein degradation
N01146  Mutation-inactivated UBQLN2 to 26S proteasome-mediated protein degradation
N01197  Scrapie conformation PrPSc to 26S proteasome-mediated protein degradation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    5705 (PSMC5)
 09160 Human Diseases
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    5705 (PSMC5)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    5705 (PSMC5)
   05012 Parkinson disease
    5705 (PSMC5)
   05014 Amyotrophic lateral sclerosis
    5705 (PSMC5)
   05016 Huntington disease
    5705 (PSMC5)
   05017 Spinocerebellar ataxia
    5705 (PSMC5)
   05020 Prion disease
    5705 (PSMC5)
   05022 Pathways of neurodegeneration - multiple diseases
    5705 (PSMC5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:hsa03051]
    5705 (PSMC5)
Proteasome [BR:hsa03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    ATPase subunits
     5705 (PSMC5)
SSDB
Motif
Pfam: AAA AAA_lid_3 Prot_ATP_ID_OB AAA_2 AAA_5 AAA_16 AAA_22 RuvB_N TIP49 AAA_33 AAA_18 AAA_3 Mg_chelatase ATPase PhoH IstB_IS21 AAA_28 AAA_24 AAA_14 Sigma54_activat AAA_17 DUF815 AAA_7 bpMoxR Parvo_NS1 AAA_25 Zeta_toxin RNA_helicase TsaE HR1 AAA_19 AAA_11
Other DBs
NCBI-GeneID: 5705
NCBI-ProteinID: NP_002796
OMIM: 601681
HGNC: 9552
Ensembl: ENSG00000087191
Vega: OTTHUMG00000179013
Pharos: P62195(Tbio)
UniProt: P62195 A0A140VJS3
Structure
PDB: 

Position
17q23.3
AA seq 406 aa
MALDGPEQMELEEGKAGSGLRQYYLSKIEELQLIVNDKSQNLRRLQAQRNELNAKVRLLR
EELQLLQEQGSYVGEVVRAMDKKKVLVKVHPEGKFVVDVDKNIDINDVTPNCRVALRNDS
YTLHKILPNKVDPLVSLMMVEKVPDSTYEMIGGLDKQIKEIKEVIELPVKHPELFEALGI
AQPKGVLLYGPPGTGKTLLARAVAHHTDCTFIRVSGSELVQKFIGEGARMVRELFVMARE
HAPSIIFMDEIDSIGSSRLEGGSGGDSEVQRTMLELLNQLDGFEATKNIKVIMATNRIDI
LDSALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMNLTRGINLRKIAELMPGASGAEVK
GVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEKNMSIKKLWK
NT seq 1221 nt   +upstreamnt  +downstreamnt
atggcgcttgacggaccagagcagatggagctggaggaggggaaggcaggcagcggactc
cgccaatattatctgtccaagattgaagaactccagctgattgtgaatgataagagccaa
aacctccggaggctgcaggcacagaggaacgaactaaatgctaaagttcgcctattgcgg
gaggagctacagctgctgcaggagcagggctcctatgtgggggaagtagtccgggccatg
gataagaagaaagtgttggtcaaggtacatcctgaaggtaaatttgttgtagacgtggac
aaaaacattgacatcaatgatgtgacacccaattgccgggtggctctaaggaatgacagc
tacactctgcacaagatcctgcccaacaaggtagacccattagtgtcactgatgatggtg
gagaaagtaccagattcaacttatgagatgattggtggactggacaaacagatcaaggag
atcaaagaagtgatcgagctgcctgttaagcatcctgagctcttcgaagcactgggcatt
gctcagcccaagggagtgctgctgtatggacctccaggcactgggaagacactgttggcc
cgggctgtggctcatcatacggactgtacctttattcgtgtctctggctctgaactggta
cagaaattcataggggaaggggcaagaatggtgagggagctgtttgtcatggcacgggaa
catgctccatctatcatcttcatggacgaaatcgactccatcggctcctcgcggctggag
gggggttctggaggggacagtgaagtgcagcgcacgatgctggagttgctcaaccagctc
gacggctttgaggccaccaagaacatcaaggttatcatggctactaataggattgatatc
ctggactcggcactgcttcgcccagggcgcattgacagaaaaattgaattcccacccccc
aatgaggaggcccggctggacattttgaagattcattctcggaagatgaacctgacccgg
gggatcaacctgagaaaaattgctgagctcatgccaggagcatcaggggctgaagtgaag
ggcgtgtgcacagaagctggcatgtatgccctgcgagaacggcgagtccatgtcactcag
gaggactttgagatggcagtagccaaggtcatgcagaaggacagtgagaaaaacatgtcc
atcaagaaattatggaagtga

DBGET integrated database retrieval system