KEGG   Homo sapiens (human): 5705Help
Entry
5705              CDS       T01001                                 

Gene name
PSMC5, S8, SUG-1, SUG1, TBP10, TRIP1, p45, p45/SUG
Definition
(RefSeq) proteasome 26S subunit, ATPase 5
  KO
K03066  26S proteasome regulatory subunit T6
Organism
hsa  Homo sapiens (human)
Pathway
hsa03050  Proteasome
hsa05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    5705 (PSMC5)
 09160 Human Diseases
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    5705 (PSMC5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:hsa03051]
    5705 (PSMC5)
Proteasome [BR:hsa03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    ATPase subunits
     5705 (PSMC5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AAA AAA_lid_3 AAA_2 Prot_ATP_ID_OB AAA_5 AAA_16 AAA_22 RuvB_N TIP49 AAA_33 IstB_IS21 AAA_18 AAA_3 Mg_chelatase PhoH ATPase AAA_28 RILP Sigma54_activat AAA_7 AAA_24 TsaE Parvo_NS1 AAA_14 AAA_25 DUF815 AAA_17 RNA_helicase AAA_11 Zeta_toxin AAA_19 DivIC
Motif
Other DBs
NCBI-GeneID: 5705
NCBI-ProteinID: NP_002796
OMIM: 601681
HGNC: 9552
Ensembl: ENSG00000087191
Vega: OTTHUMG00000179013
Pharos: P62195(Tbio)
UniProt: P62195 A0A140VJS3
Structure
PDB: 

Position
17q23.3
AA seq 406 aa AA seqDB search
MALDGPEQMELEEGKAGSGLRQYYLSKIEELQLIVNDKSQNLRRLQAQRNELNAKVRLLR
EELQLLQEQGSYVGEVVRAMDKKKVLVKVHPEGKFVVDVDKNIDINDVTPNCRVALRNDS
YTLHKILPNKVDPLVSLMMVEKVPDSTYEMIGGLDKQIKEIKEVIELPVKHPELFEALGI
AQPKGVLLYGPPGTGKTLLARAVAHHTDCTFIRVSGSELVQKFIGEGARMVRELFVMARE
HAPSIIFMDEIDSIGSSRLEGGSGGDSEVQRTMLELLNQLDGFEATKNIKVIMATNRIDI
LDSALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMNLTRGINLRKIAELMPGASGAEVK
GVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEKNMSIKKLWK
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atggcgcttgacggaccagagcagatggagctggaggaggggaaggcaggcagcggactc
cgccaatattatctgtccaagattgaagaactccagctgattgtgaatgataagagccaa
aacctccggaggctgcaggcacagaggaacgaactaaatgctaaagttcgcctattgcgg
gaggagctacagctgctgcaggagcagggctcctatgtgggggaagtagtccgggccatg
gataagaagaaagtgttggtcaaggtacatcctgaaggtaaatttgttgtagacgtggac
aaaaacattgacatcaatgatgtgacacccaattgccgggtggctctaaggaatgacagc
tacactctgcacaagatcctgcccaacaaggtagacccattagtgtcactgatgatggtg
gagaaagtaccagattcaacttatgagatgattggtggactggacaaacagatcaaggag
atcaaagaagtgatcgagctgcctgttaagcatcctgagctcttcgaagcactgggcatt
gctcagcccaagggagtgctgctgtatggacctccaggcactgggaagacactgttggcc
cgggctgtggctcatcatacggactgtacctttattcgtgtctctggctctgaactggta
cagaaattcataggggaaggggcaagaatggtgagggagctgtttgtcatggcacgggaa
catgctccatctatcatcttcatggacgaaatcgactccatcggctcctcgcggctggag
gggggttctggaggggacagtgaagtgcagcgcacgatgctggagttgctcaaccagctc
gacggctttgaggccaccaagaacatcaaggttatcatggctactaataggattgatatc
ctggactcggcactgcttcgcccagggcgcattgacagaaaaattgaattcccacccccc
aatgaggaggcccggctggacattttgaagattcattctcggaagatgaacctgacccgg
gggatcaacctgagaaaaattgctgagctcatgccaggagcatcaggggctgaagtgaag
ggcgtgtgcacagaagctggcatgtatgccctgcgagaacggcgagtccatgtcactcag
gaggactttgagatggcagtagccaaggtcatgcagaaggacagtgagaaaaacatgtcc
atcaagaaattatggaagtga

DBGET integrated database retrieval system