KEGG   Homo sapiens (human): 57054Help
Entry
57054             CDS       T01001                                 

Gene name
DAZ3, pDP1679
Definition
(RefSeq) deleted in azoospermia 3
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: RRM_1 RRM_7 RRM_5
Motif
Other DBs
NCBI-GeneID: 57054
NCBI-ProteinID: NP_065097
OMIM: 400027
HGNC: 15965
Ensembl: ENSG00000187191
Vega: OTTHUMG00000045099
Pharos: Q9NR90(Tbio)
UniProt: Q9NR90
Position
Yq11.23
AA seq 438 aa AA seqDB search
MSAANPETPNSTISREASTQSSSAAASQGWVLPEGKIVPNTVFVGGIDARMDETEIGSCF
GRYGSVKEVKIITNRTGVSKGYGFVSFVNDVDVQKIVGSQIHFHGKKLKLGPAIRKQKLC
ARHVQPRPLVVNPPPPPQFQNVWRNPNTETYLQPQITPNPVTQHVQAYSAYPHSPGQVIT
GCQLLVYNYQEYPTYPDSAFQVTTGYQLPVYNYQPFPAYPRSPFQVTAGYQLPVYNYQAF
PAYPNSPFQVATGYQFPVYNYQAFPAYPNSPVQVTTGYQLPVYNYQAFPAYPNSPFQVAT
GYQFPVYNYQAFPAYPNSPVQVTTGYQLPVYNYQAFPAYPNSPFQVATGYQFPVYNYQAF
PAYPNSPVQVTTGYQLPVYNYQAFPAYPNSAVQVTTGYQFHVYNYQMPPQCPVGEQRRNL
WTEAYKWWYLVCLIQRRD
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgtctgctgcaaatcctgagactccaaactcaaccatctccagagaggccagcacccag
tcttcatcagctgcagctagccaaggctgggtgttaccagaaggcaaaatcgtgccaaac
actgtttttgttggtggaattgatgctaggatggatgaaactgagattggaagctgcttt
ggtagatacggttcagtgaaagaagtgaagataatcacgaatcgaactggtgtgtccaaa
ggctatggatttgtttcgtttgttaatgacgtggatgtccagaagatagtaggatcacag
atacatttccatggtaaaaagctgaagctgggccctgcaatcaggaaacaaaagttatgt
gctcgtcatgtgcagccacgtcctttggtagttaatcctcctcctccaccacagtttcag
aacgtctggcggaatccaaacactgaaacctacctgcagccccaaatcacgccgaatcct
gtaactcagcacgttcaggcttactctgcttatccacattcaccaggtcaggtcatcact
ggatgtcagttgcttgtatataattatcaggaatatcctacttatcccgattcagcattt
caggtcaccactggatatcagttgcctgtatataattatcagccatttcctgcttatcca
agatcaccatttcaggtcactgctggatatcagttgcctgtatataattatcaggcattt
cctgcttatccaaattcaccatttcaagtcgccactggatatcagttccctgtatacaat
tatcaggcatttcctgcttatccaaattcaccagttcaggtcaccactggatatcagttg
cctgtatacaattatcaggcatttcctgcttatccaaattcaccatttcaagtcgccact
ggatatcagttccctgtatacaattatcaggcatttcctgcttatccaaattcaccagtt
caggtcaccactggatatcagttgcctgtatacaattatcaggcatttcctgcttatcca
aattcaccatttcaagtcgccactggatatcagttccctgtatacaattatcaggcattt
cctgcttatccaaattcaccagttcaggtcaccactggatatcagttgcctgtatacaat
tatcaggcatttcctgcttatccaaattcagcagttcaggtcaccactggatatcagttc
catgtatacaattaccagatgccaccgcagtgccctgttggggagcaaaggagaaatctg
tggaccgaagcatacaaatggtggtatcttgtctgtttaatccagagaagagactga

DBGET integrated database retrieval system