KEGG   Homo sapiens (human): 57057Help
Entry
57057             CDS       T01001                                 

Gene name
TBX20, ASD4
Definition
(RefSeq) T-box transcription factor 20
  KO
K10185  T-box protein 20
Organism
hsa  Homo sapiens (human)
Disease
H00546  Atrial septal defect
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    57057 (TBX20)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Other transcription factors
   T-box
    57057 (TBX20)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: T-box Patatin
Motif
Other DBs
NCBI-GeneID: 57057
NCBI-ProteinID: NP_001071121
OMIM: 606061
HGNC: 11598
Ensembl: ENSG00000164532
Vega: OTTHUMG00000099411
Pharos: Q9UMR3(Tbio)
UniProt: Q9UMR3
Position
7p14.2
AA seq 447 aa AA seqDB search
MEFTASPKPQLSSRANAFSIAALMSSGGSKEKEATENTIKPLEQFVEKSSCAQPLGELTS
LDAHGEFGGGSGSSPSSSSLCTEPLIPTTPIIPSEEMAKIACSLETKELWDKFHELGTEM
IITKSGRRMFPTIRVSFSGVDPEAKYIVLMDIVPVDNKRYRYAYHRSSWLVAGKADPPLP
ARLYVHPDSPFTGEQLLKQMVSFEKVKLTNNELDQHGHIILNSMHKYQPRVHIIKKKDHT
ASLLNLKSEEFRTFIFPETVFTAVTAYQNQLITKLKIDSNPFAKGFRDSSRLTDIERESV
ESLIQKHSYARSPIRTYGGEEDVLGDESQTTPNRGSAFTTSDNLSLSSWVSSSSSFPGFQ
HPQSLTALGTSTASIATPIPHPIQGSLPPYSRLGMPLTPSAIASSMQGSGPTFPSFHMPR
YHHYFQQGPYAAIQGLRHSSAVMTPFV
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atggagttcacggcgtcccccaagccccaactctcctctcgggccaacgccttctccatt
gccgcgctcatgtcgagcggcggctctaaggagaaggaggcgacggagaacacaatcaaa
cccctggagcaatttgtggagaagtcgtcctgtgcccagcccctgggtgagctgaccagc
ctggatgctcatggggagtttggtggaggcagtggcagcagcccgtcctcctcctctctg
tgcactgagccactgatccccaccacccccatcatccccagtgaggaaatggccaaaatt
gcctgcagcctggagaccaaggagctttgggacaaattccatgagctgggcaccgagatg
atcatcaccaagtcgggcaggaggatgtttccaaccatccgggtgtccttttcgggggtg
gatcctgaggccaagtacatagtcctgatggacatcgtccctgtggacaacaagaggtac
cgctacgcctaccaccggtcctcctggctggtggctggcaaggccgacccgccgttgcca
gccaggctctatgtgcatccagattctccttttaccggtgagcaactactcaaacagatg
gtgtcttttgaaaaggtgaaactcaccaacaatgaactggatcaacatggccatataatt
ttgaactcaatgcataagtaccagccaagggtgcacatcattaagaagaaagaccacaca
gcctcattgctcaacctgaagtctgaagaatttagaactttcatctttccagaaacagtt
tttacggcagtcactgcctaccagaatcaactgataacgaagctgaaaatagatagcaat
ccttttgccaaaggattccgggattcctccaggctcactgacattgagagggaaagtgtg
gagagcctgattcaaaagcattcctatgcacgctcacccatccgtacctacggaggagaa
gaagatgtcttgggggatgagagtcagacaaccccaaatcgagggtcagcctttacaaca
tctgataatttgtctctcagctcctgggtatcatcttcttccagttttcctgggtttcag
cacccacagtccctgactgctcttggcaccagcacagcatccatagcaacacccattcct
caccccatccagggttctctgccaccatatagccgactgggaatgcctctgacaccatcg
gccattgccagctccatgcaagggagtggccccacattcccttcattccacatgccgcga
taccatcactattttcagcaggggccctatgctgccattcaaggactacgccattcctct
gctgtgatgacgccatttgtatga

DBGET integrated database retrieval system