KEGG   Homo sapiens (human): 5707
Entry
5707              CDS       T01001                                 

Gene name
PSMD1, P112, Rpn2, S1
Definition
(RefSeq) proteasome 26S subunit, non-ATPase 1
  KO
K03032  26S proteasome regulatory subunit N2
Organism
hsa  Homo sapiens (human)
Pathway
hsa03050  Proteasome
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05016  Huntington disease
hsa05017  Spinocerebellar ataxia
hsa05169  Epstein-Barr virus infection
Network
nt06420  Ubiquitin-proteasome system
nt06460  Alzheimer disease
nt06461  Huntington disease
nt06463  Parkinson disease
  Element
N01029  26S proteasome-mediated protein degradation
N01030  Mutation-caused aberrant SNCA to 26S proteasome-mediated protein degradation
N01060  Mutation-caused aberrant Abeta to 26S proteasome-mediated protein degradation
N01061  Mutation-caused aberrant Htt to 26S proteasome-mediated protein degradation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    5707 (PSMD1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    5707 (PSMD1)
   05012 Parkinson disease
    5707 (PSMD1)
   05016 Huntington disease
    5707 (PSMD1)
   05017 Spinocerebellar ataxia
    5707 (PSMD1)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    5707 (PSMD1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:hsa03051]
    5707 (PSMD1)
Proteasome [BR:hsa03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    non-ATPase subunits
     5707 (PSMD1)
SSDB
Motif
Pfam: RPN2_C PC_rep HEAT_2 HEAT_EZ Tim54
Other DBs
NCBI-GeneID: 5707
NCBI-ProteinID: NP_002798
OMIM: 617842
HGNC: 9554
Ensembl: ENSG00000173692
Vega: OTTHUMG00000133223
Pharos: Q99460(Tbio)
UniProt: Q99460
Structure
PDB: 

Position
2q37.1
AA seq 953 aa
MITSAAGIISLLDEDEPQLKEFALHKLNAVVNDFWAEISESVDKIEVLYEDEGFRSRQFA
ALVASKVFYHLGAFEESLNYALGAGDLFNVNDNSEYVETIIAKCIDHYTKQCVENADLPE
GEKKPIDQRLEGIVNKMFQRCLDDHKYKQAIGIALETRRLDVFEKTILESNDVPGMLAYS
LKLCMSLMQNKQFRNKVLRVLVKIYMNLEKPDFINVCQCLIFLDDPQAVSDILEKLVKED
NLLMAYQICFDLYESASQQFLSSVIQNLRTVGTPIASVPGSTNTGTVPGSEKDSDSMETE
EKTSSAFVGKTPEASPEPKDQTLKMIKILSGEMAIELHLQFLIRNNNTDLMILKNTKDAV
RNSVCHTATVIANSFMHCGTTSDQFLRDNLEWLARATNWAKFTATASLGVIHKGHEKEAL
QLMATYLPKDTSPGSAYQEGGGLYALGLIHANHGGDIIDYLLNQLKNASNDIVRHGGSLG
LGLAAMGTARQDVYDLLKTNLYQDDAVTGEAAGLALGLVMLGSKNAQAIEDMVGYAQETQ
HEKILRGLAVGIALVMYGRMEEADALIESLCRDKDPILRRSGMYTVAMAYCGSGNNKAIR
RLLHVAVSDVNDDVRRAAVESLGFILFRTPEQCPSVVSLLSESYNPHVRYGAAMALGICC
AGTGNKEAINLLEPMTNDPVNYVRQGALIASALIMIQQTEITCPKVNQFRQLYSKVINDK
HDDVMAKFGAILAQGILDAGGHNVTISLQSRTGHTHMPSVVGVLVFTQFWFWFPLSHFLS
LAYTPTCVIGLNKDLKMPKVQYKSNCKPSTFAYPAPLEVPKEKEKEKVSTAVLSITAKAK
KKEKEKEKKEEEKMEVDEAEKKEEKEKKKEPEPNFQLLDNPARVMPAQLKVLTMPETCRY
QPFKPLSIGGIIILKDTSEDIEELVEPVAAHGPKIEEEEQEPEPPEPFEYIDD
NT seq 2862 nt   +upstreamnt  +downstreamnt
atgatcacctcggccgctggaattatttctcttctggatgaagatgaaccacagcttaag
gaatttgcactacacaaattgaatgcagttgttaatgacttctgggcagaaatttccgag
tccgtagacaaaatagaggttttatacgaagatgaaggtttccggagtcggcagtttgca
gccttagtggcatctaaagtattttatcacctgggggcttttgaggagtctctgaattat
gctcttggagcaggggacctcttcaatgtcaatgataactctgaatatgtggaaactatt
atagcaaaatgcattgatcactacaccaaacaatgtgtggaaaatgcagatttgcctgaa
ggagaaaaaaaaccaattgaccagagattggaaggcatcgtaaataaaatgttccagcga
tgtctagatgatcacaagtataaacaggctattggcattgctctggagacacgaagactg
gacgtctttgaaaagaccatactggagtcgaatgatgtcccaggaatgttagcttatagc
cttaagctctgcatgtctttaatgcagaataaacagtttcggaataaagtactaagagtt
ctagttaaaatctacatgaacttggagaaacctgatttcatcaatgtttgtcagtgctta
attttcttagatgatcctcaggctgtgagtgatatcttagagaaactggtaaaggaagac
aacctcctgatggcatatcagatttgttttgatttgtatgaaagtgctagccagcagttt
ttgtcatctgtaatccagaatcttcgaactgttggcacccctattgcttctgtgcctgga
tccactaatacgggtactgttccgggatcagagaaagacagtgactcgatggaaacagaa
gaaaagacaagcagtgcatttgtaggaaagacaccagaagccagtccagagcctaaggac
cagactttgaaaatgattaaaattttaagtggtgaaatggctattgagttacatctgcag
ttcttaatacgaaacaataatacagacctcatgattctaaaaaacacaaaggatgcagta
cggaattctgtatgtcatactgcaaccgttatagcaaactcttttatgcactgtgggaca
accagtgaccagtttcttagagataatttggaatggttagccagagccactaactgggca
aaatttactgctacagccagtttgggtgtaattcataagggtcatgaaaaagaagcatta
cagttaatggcaacataccttcccaaggatacttctccaggatcagcctatcaggaaggt
ggaggtctctatgcactaggtcttattcatgccaatcatggtggtgatataattgactat
ctgcttaatcagcttaagaacgccagcaatgatatcgttagacacggtggcagtctgggc
cttggtttggcagccatgggaactgcacgtcaagatgtttatgatttgctaaaaacaaac
ctttatcaggatgatgcagtaacaggggaagcagctggcctggccctaggtttggttatg
ttgggctctaaaaatgctcaggctattgaggacatggttggttatgcacaagaaactcaa
catgagaagattctgcgtggtcttgcagttggcatagctttagtaatgtatgggaggatg
gaagaggctgatgctctcattgaatctctctgtcgtgacaaggacccaattcttcgaagg
tctggaatgtatactgtagccatggcttattgtggctctggtaacaacaaagcaattcga
cgcctgctacatgttgctgtaagtgatgttaatgatgatgtcaggagggcagcagtagaa
tcacttgggttcattctattcagaacccctgaacagtgcccaagtgttgtctctttgttg
tcagagagttacaaccctcatgtgcgctacggagctgcaatggccttggggatatgctgt
gctggtacaggaaacaaggaagccattaatttgctagaaccaatgacaaacgaccccgtg
aactacgtgaggcaaggggcactcatagcttcagctctcatcatgatccagcagactgaa
atcacttgtccaaaggtgaatcagttcagacagctgtattccaaagtcatcaatgataag
catgatgatgtcatggccaagtttggcgctattctggcccagggcatactggatgcaggt
ggtcataatgtcacaatctccttgcagtccaggactgggcatactcatatgccttctgtg
gttggcgtccttgtatttacccagttttggttctggtttcctctttcacacttcctgtca
ttggcttatacccctacctgtgtcattggccttaacaaggacttaaagatgccgaaagtt
cagtataaatcgaactgtaaaccatccacatttgcatatcctgcccctctggaagtacca
aaagaaaaagaaaaggaaaaggtttctactgctgtattatctataactgccaaggctaaa
aagaaggaaaaagaaaaggaaaaaaaggaggaggagaaaatggaagtggatgaggcagag
aaaaaggaggaaaaagagaagaaaaaagaacctgagccaaacttccagttattggataac
ccagcccgagttatgcctgcccagcttaaggtcctaaccatgccggagacctgtagatac
cagcctttcaaaccactctctattggaggcatcatcattctgaaggataccagtgaagac
attgaggagctggtggaacctgtggcagcacatggcccaaaaatcgaggaggaggaacaa
gagccagaacccccagaaccatttgagtatattgatgattaa

DBGET integrated database retrieval system