KEGG   Homo sapiens (human): 5708
Entry
5708              CDS       T01001                                 

Gene name
PSMD2, P97, RPN1, S2, TRAP2
Definition
(RefSeq) proteasome 26S subunit ubiquitin receptor, non-ATPase 2
  KO
K03028  26S proteasome regulatory subunit N1
Organism
hsa  Homo sapiens (human)
Pathway
hsa03050  Proteasome
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05017  Spinocerebellar ataxia
hsa05020  Prion disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05169  Epstein-Barr virus infection
Network
nt06420  Ubiquitin-proteasome system
nt06460  Alzheimer disease
nt06461  Huntington disease
nt06463  Parkinson disease
nt06464  Amyotrophic lateral sclerosis
nt06465  Prion disease
  Element
N01029  26S proteasome-mediated protein degradation
N01030  Mutation-caused aberrant SNCA to 26S proteasome-mediated protein degradation
N01060  Mutation-caused aberrant Abeta to 26S proteasome-mediated protein degradation
N01061  Mutation-caused aberrant Htt to 26S proteasome-mediated protein degradation
N01144  Mutation-caused aberrant SOD1 to 26S proteasome-mediated protein degradation
N01145  Mutation-inactivated VCP to 26S proteasome-mediated protein degradation
N01146  Mutation-inactivated UBQLN2 to 26S proteasome-mediated protein degradation
N01197  Scrapie conformation PrPSc to 26S proteasome-mediated protein degradation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    5708 (PSMD2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    5708 (PSMD2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    5708 (PSMD2)
   05012 Parkinson disease
    5708 (PSMD2)
   05014 Amyotrophic lateral sclerosis
    5708 (PSMD2)
   05016 Huntington disease
    5708 (PSMD2)
   05017 Spinocerebellar ataxia
    5708 (PSMD2)
   05020 Prion disease
    5708 (PSMD2)
   05022 Pathways of neurodegeneration - multiple diseases
    5708 (PSMD2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:hsa03051]
    5708 (PSMD2)
Proteasome [BR:hsa03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    non-ATPase subunits
     5708 (PSMD2)
SSDB
Motif
Pfam: RPN1_RPN2_N RPN1_C PC_rep THAP
Other DBs
NCBI-GeneID: 5708
NCBI-ProteinID: NP_002799
OMIM: 606223
HGNC: 9559
Ensembl: ENSG00000175166
Vega: OTTHUMG00000156796
Pharos: Q13200(Tbio)
UniProt: Q13200
Structure
PDB: 

Position
3q27.1
AA seq 908 aa
MEEGGRDKAPVQPQQSPAAAPGGTDEKPSGKERRDAGDKDKEQELSEEDKQLQDELEMLV
ERLGEKDTSLYRPALEELRRQIRSSTTSMTSVPKPLKFLRPHYGKLKEIYENMAPGENKR
FAADIISVLAMTMSGERECLKYRLVGSQEELASWGHEYVRHLAGEVAKEWQELDDAEKVQ
REPLLTLVKEIVPYNMAHNAEHEACDLLMEIEQVDMLEKDIDENAYAKVCLYLTSCVNYV
PEPENSALLRCALGVFRKFSRFPEALRLALMLNDMELVEDIFTSCKDVVVQKQMAFMLGR
HGVFLELSEDVEEYEDLTEIMSNVQLNSNFLALARELDIMEPKVPDDIYKTHLENNRFGG
SGSQVDSARMNLASSFVNGFVNAAFGQDKLLTDDGNKWLYKNKDHGMLSAAASLGMILLW
DVDGGLTQIDKYLYSSEDYIKSGALLACGIVNSGVRNECDPALALLSDYVLHNSNTMRLG
SIFGLGLAYAGSNREDVLTLLLPVMGDSKSSMEVAGVTALACGMIAVGSCNGDVTSTILQ
TIMEKSETELKDTYARWLPLGLGLNHLGKGEAIEAILAALEVVSEPFRSFANTLVDVCAY
AGSGNVLKVQQLLHICSEHFDSKEKEEDKDKKEKKDKDKKEAPADMGAHQGVAVLGIALI
AMGEEIGAEMALRTFGHLLRYGEPTLRRAVPLALALISVSNPRLNILDTLSKFSHDADPE
VSYNSIFAMGMVGSGTNNARLAAMLRQLAQYHAKDPNNLFMVRLAQGLTHLGKGTLTLCP
YHSDRQLMSQVAVAGLLTVLVSFLDVRNIILGKSHYVLYGLVAAMQPRMLVTFDEELRPL
PVSVRVGQAVDVVGQAGKPKTITGFQTHTTPVLLAHGERAELATEEFLPVTPILEGFVIL
RKNPNYDL
NT seq 2727 nt   +upstreamnt  +downstreamnt
atggaggagggaggccgggacaaggcgccggtgcagccccagcagtctccagcggcggcc
cccggcggcacggacgagaagccgagcggcaaggagcggcgggatgccggggacaaggac
aaagaacaggagctgtctgaagaggataaacagcttcaagatgaactggagatgctcgtg
gaacgactaggggagaaggatacatccctgtatcgaccagcgctggaggaattgcgaagg
cagattcgttcttctacaacttccatgacttcagtgcccaagcctctcaaatttctgcgt
ccacactatggcaaactgaaggaaatctatgagaacatggcccctggggagaataagcgt
tttgctgctgacatcatctccgttttggccatgaccatgagtggggagcgtgagtgcctc
aagtatcggctagtgggctcccaggaggaattggcatcatggggtcatgagtatgtcagg
catctggcaggagaagtggctaaggagtggcaggagctggatgacgcagagaaggtccag
cgggagcctctgctcactctggtgaaggaaatcgtcccctataacatggcccacaatgca
gagcatgaggcttgcgacctgcttatggaaattgagcaggtggacatgctggagaaggac
attgatgaaaatgcatatgcaaaggtctgcctttatctcaccagttgtgtgaattacgtg
cctgagcctgagaactcagccctactgcgttgtgccctgggtgtgttccgaaagtttagc
cgcttccctgaagctctgagattggcattgatgctcaatgacatggagttggtagaagac
atcttcacctcctgcaaggatgtggtagtacagaaacagatggcattcatgctaggccgg
catggggtgttcctggagctgagtgaagatgtcgaggagtatgaggacctgacagagatc
atgtccaatgtacagctcaacagcaacttcttggccttagctcgggagctggacatcatg
gagcccaaggtgcctgatgacatctacaaaacccacctagagaacaacaggtttgggggc
agtggctctcaggtggactctgcccgcatgaacctggcctcctcttttgtgaatggcttt
gtgaatgcagcttttggccaagacaagctgctaacagatgatggcaacaaatggctttac
aagaacaaggaccacggaatgttgagtgcagctgcatctcttgggatgattctgctgtgg
gatgtggatggtggcctcacccagattgacaagtacctgtactcctctgaggactacatt
aagtcaggagctcttcttgcctgtggcatagtgaactctggggtccggaatgagtgtgac
cctgctctggcactgctctcagactatgttctccacaacagcaacaccatgagacttggt
tccatctttgggctaggcttggcttatgctggctcaaatcgtgaagatgtcctaacactg
ctgctgcctgtgatgggagattcaaagtccagcatggaggtggcaggtgtcacagcttta
gcctgtggaatgatagcagtagggtcctgcaatggagatgtaacttccactatccttcag
accatcatggagaagtcagagactgagctcaaggatacttatgctcgttggcttcctctt
ggactgggtctcaaccacctggggaagggtgaggccatcgaggcaatcctggctgcactg
gaggttgtgtcagagccattccgcagttttgccaacacactggtggatgtgtgtgcatat
gcaggctctgggaatgtgctgaaggtgcagcagctgctccacatttgtagcgaacacttt
gactccaaagagaaggaggaagacaaagacaagaaggaaaagaaagacaaggacaagaag
gaagcccctgctgacatgggagcacatcagggagtggctgttctggggattgcccttatt
gctatgggggaggagattggtgcagagatggcattacgaacctttggccacttgctgaga
tatggggagcctacactccggagggctgtacctttagcactggccctcatctctgtttca
aatccacgactcaacatcctggataccctaagcaaattctctcatgatgctgatccagaa
gtttcctataactccatttttgccatgggcatggtgggcagtggtaccaataatgcccgt
ctggctgcaatgctgcgccagttagctcaatatcatgccaaggacccaaacaacctcttc
atggtgcgcttggcacagggcctgacacatttagggaagggcacccttaccctctgcccc
taccacagcgaccggcagcttatgagccaggtggccgtggctggactgctcactgtgctt
gtctctttcctggatgttcgaaacattattctaggcaaatcacactatgtattgtatggg
ctggtggctgccatgcagccccgaatgctggttacgtttgatgaggagctgcggccattg
ccagtgtctgtccgtgtgggccaggcagtggatgtggtgggccaggctggcaagccgaag
actatcacagggttccagacgcatacaaccccagtgttgttggcccacggggaacgggca
gaattggccactgaggagtttcttcctgttacccccattctggaaggttttgttatcctt
cggaagaaccccaattatgatctctaa

DBGET integrated database retrieval system