KEGG   Homo sapiens (human): 57082Help
Entry
57082             CDS       T01001                                 

Gene name
KNL1, AF15Q14, CASC5, CT29, D40, MCPH4, PPP1R55, Spc7, hKNL-1, hSpc105
Definition
(RefSeq) kinetochore scaffold 1
  KO
K11542  protein CASC5
Organism
hsa  Homo sapiens (human)
Disease
H00269  Primary microcephaly
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    57082 (KNL1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    57082 (KNL1)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     57082 (KNL1)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Centromeric chromatin formation proteins
   Kinetochore proteins
    KMN network proteins
     57082 (KNL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Knl1_RWD_C
Motif
Other DBs
NCBI-GeneID: 57082
NCBI-ProteinID: NP_733468
OMIM: 609173
HGNC: 24054
Ensembl: ENSG00000137812
Vega: OTTHUMG00000166532
Pharos: Q8NG31(Tbio)
UniProt: Q8NG31
Structure
PDB: 

Position
15q15.1
AA seq 2342 aa AA seqDB search
MDGVSSEANEENDNIERPVRRRHSSILKPPRSPLQDLRGGNERVQESNALRNKKNSRRVS
FADTIKVFQTESHMKIVRKSEMEGCSAMVPSQLQLLPPGFKRFSCLSLPETETGENLLLI
QNKKLEDNYCEITGMNTLLSAPIHTQMQQKEFSIIEHTRERKHANDQTVIFSDENQMDLT
SSHTVMITKGLLDNPISEKSTKIDTTSFLANLKLHTEDSRMKKEVNFSVDQNTSSENKID
FNDFIKRLKTGKCSAFPDVPDKENFEIPIYSKEPNSASSTHQMHVSLKEDENNSNITRLF
REKDDGMNFTQCHTANIQTLIPTSSETNSRESKGNDITIYGNDFMDLTFNHTLQILPATG
NFSEIENQTQNAMDVTTGYGTKASGNKTVFKSKQNTAFQDLSINSADKIHITRSHIMGAE
THIVSQTCNQDARILAMTPESIYSNPSIQGCKTVFYSSCNDAMEMTKCLSNMREEKNLLK
HDSNYAKMYCNPDAMSSLTEKTIYSGEENMDITKSHTVAIDNQIFKQDQSNVQIAAAPTP
EKEMMLQNLMTTSEDGKMNVNCNSVPHVSKERIQQSLSNPLSISLTDRKTELLSGENMDL
TESHTSNLGSQVPLAAYNLAPESTSESHSQSKSSSDECEEITKSRNEPFQRSDIIAKNSL
TDTWNKDKDWVLKILPYLDKDSPQSADCNQEIATSHNIVYCGGVLDKQITNRNTVSWEQS
LFSTTKPLFSSGQFSMKNHDTAISSHTVKSVLGQNSKLAEPLRKSLSNPTPDYCHDKMII
CSEEEQNMDLTKSHTVVIGFGPSELQELGKTNLEHTTGQLTTMNRQIAVKVEKCGKSPIE
KSGVLKSNCIMDVLEDESVQKPKFPKEKQNVKIWGRKSVGGPKIDKTIVFSEDDKNDMDI
TKSYTIEINHRPLLEKRDCHLVPLAGTSETILYTCRQDDMEITRSHTTALECKTVSPDEI
TTRPMDKTVVFVDNHVELEMTESHTVFIDYQEKERTDRPNFELSQRKSLGTPTVICTPTE
ESVFFPGNGESDRLVANDSQLTPLEEWSNNRGPVEVADNMELSKSATCKNIKDVQSPGFL
NEPLSSKSQRRKSLKLKNDKTIVFSENHKNDMDITQSCMVEIDNESALEDKEDFHLAGAS
KTILYSCGQDDMEITRSHTTALECKTLLPNEIAIRPMDKTVLFTDNYSDLEVTDSHTVFI
DCQATEKILEENPKFGIGKGKNLGVSFPKDNSCVQEIAEKQALAVGNKIVLHTEQKQQLF
AATNRTTNEIIKFHSAAMDEKVIGKVVDQACTLEKAQVESCQLNNRDRRNVDFTSSHATA
VCGSSDNYSCLPNVISCTDNLEGSAMLLCDKDEEKANYCPVQNDLAYANDFASEYYLESE
GQPLSAPCPLLEKEEVIQTSTKGQLDCVITLHKDQDLIKDPRNLLANQTLVYSQDLGEMT
KLNSKRVSFKLPKDQMKVYVDDIYVIPQPHFSTDQPPLPKKGQSSINKEEVILSKAGNKS
LNIIENSSAPICENKPKILNSEEWFAAACKKELKENIQTTNYNTALDFHSNSDVTKQVIQ
THVNAGEAPDPVITSNVPCFHSIKPNLNNLNGKTGEFLAFQTVHLPPLPEQLLELGNKAH
NDMHIVQATEIHNINIISSNAKDSRDEENKKSHNGAETTSLPPKTVFKDKVRRCSLGIFL
PRLPNKRNCSVTGIDDLEQIPADTTDINHLETQPVSSKDSGIGSVAGKLNLSPSQYINEE
NLPVYPDEINSSDSINIETEEKALIETYQKEISPYENKMGKTCNSQKRTWVQEEEDIHKE
KKIRKNEIKFSDTTQDREIFDHHTEEDIDKSANSVLIKNLSRTPSSCSSSLDSIKADGTS
LDFSTYRSSQMESQFLRDTICEESLREKLQDGRITIREFFILLQVHILIQKPRQSNLPGN
FTVNTPPTPEDLMLSQYVYRPKIQIYREDCEARRQKIEELKLSASNQDKLLVDINKNLWE
KMRHCSDKELKAFGIYLNKIKSCFTKMTKVFTHQGKVALYGKLVQSAQNEREKLQIKIDE
MDKILKKIDNCLTEMETETKNLEDEEKNNPVEEWDSEMRAAEKELEQLKTEEEELQRNLL
ELEVQKEQTLAQIDFMQKQRNRTEELLDQLSLSEWDVVEWSDDQAVFTFVYDTIQLTITF
EESVVGFPFLDKRYRKIVDVNFQSLLDEDQAPPSSLLVHKLIFQYVEEKESWKKTCTTQH
QLPKMLEEFSLVVHHCRLLGEEIEYLKRWGPNYNLMNIDINNNELRLLFSSSAAFAKFEI
TLFLSAYYPSVPLPSTIQNHVGNTSQDDIATILSKVPLENNYLKNVVKQIYQDLFQDCHF
YH
NT seq 7029 nt NT seq  +upstreamnt  +downstreamnt
atggatggggtgtcttcagaggctaatgaagaaaatgacaatatagagagacctgttaga
agacggcattcttcaatattgaaacccccaaggagtcctcttcaggacctcagaggtggg
aatgaaagagttcaggaatccaatgctttgagaaataagaaaaactctcgtcgagtcagc
tttgcagatactataaaggtattccagacggagtctcatatgaaaatagtgagaaagtca
gaaatggaaggctgcagtgcaatggtgccatctcagctgcaacttctgcctcctgggttt
aagcgattctcctgcctcagcctcccagaaacagaaacaggagaaaatcttcttttgata
cagaataagaaattagaagataattactgtgaaattactgggatgaacacattgctttct
gctcccattcatacccagatgcaacagaaggagttttcaattatagaacatacccgtgaa
aggaaacatgcaaatgaccagacagtcattttttcagatgaaaaccagatggacctgaca
tcaagtcacactgtaatgattaccaaaggccttttagataatcccataagtgaaaagtcc
accaagatagataccacatcatttctagctaatttaaagcttcacaccgaggactcaaga
atgaaaaaagaagtaaatttttccgtggatcaaaacacttcttcagaaaataaaatagat
ttcaatgacttcataaaaagattgaaaacaggaaaatgtagtgcttttcctgatgtgcct
gataaagaaaattttgagatacctatttattccaaggaaccgaacagtgcctcttctaca
catcaaatgcatgtatctcttaaggaagatgaaaataacagtaatattactaggctcttt
agagaaaaagatgatgggatgaatttcacccagtgtcatacagccaatattcagacattg
attcccacatccagtgagaccaactcacgggaatctaaaggtaatgatattacaatttat
ggcaatgactttatggacttgacatttaaccacactttgcagatcttacctgcaacaggt
aatttttctgaaatagaaaatcaaactcagaatgccatggatgtaacaacaggttatgga
actaaagcttcaggaaataaaacagtttttaagagtaaacaaaatactgcttttcaagac
ctttccataaactctgcagacaaaatacatattaccagaagtcatattatgggggcagaa
actcacatagtctcacagacttgtaatcaggatgccagaatattagccatgaccccagaa
tctatatattctaatccatctattcaaggttgtaagactgttttctattctagttgtaat
gatgccatggaaatgaccaaatgtctctcaaatatgagagaggagaaaaatttgctaaag
catgacagtaattatgctaaaatgtattgcaatccagatgctatgtcttctctcacagag
aaaactatttattccggagaggagaacatggacattaccaagagtcatacagttgcaata
gataatcaaatttttaaacaagatcaatcaaatgtgcaaatagcagctgcaccaacaccc
gaaaaagaaatgatgctccaaaatcttatgaccacatcagaagatgggaaaatgaatgta
aattgtaactcagttcctcatgtatctaaggaaagaatacagcagagcctgtcaaatcct
ttgtctatttcattgactgatagaaagactgaactcttatcaggtgaaaatatggatttg
actgaaagtcacacaagtaacttaggaagtcaggttcctcttgcagcttataatctagca
ccggagagtaccagtgaatctcactctcagagcaaaagctcttcagatgaatgtgaagaa
attaccaaaagtcgtaatgaaccatttcagcgatcagacataatagccaaaaacagctta
accgacacctggaacaaagacaaagattgggttttgaagattttgccctaccttgataaa
gattctcctcagtcagctgattgtaatcaggagatagcaacaagccataatatagtctac
tgtggtggagttcttgataaacaaataactaatagaaatacagtatcatgggaacaatct
ttgttttctaccacaaagccattattttcatcaggacagttctctatgaaaaatcatgat
actgctataagtagtcatacagtgaaatctgtactaggccagaattctaaactggctgag
ccactgaggaaaagtttaagcaatcccacacctgactattgccatgacaagatgattata
tgttcagaggaagagcaaaatatggatctaacaaagagccacactgtcgtcattggattt
ggtccttctgaactacaagaacttggtaaaactaatttagaacacactactggccagcta
acaacaatgaacagacagatagctgtaaaagttgaaaaatgtggtaaaagtcccatagaa
aaaagtggagtgcttaaatctaactgtattatggatgtgttagaggacgaaagtgtacag
aaacctaaatttccaaaggaaaagcaaaatgtcaaaatttggggaaggaaaagtgttggt
ggaccaaaaattgataagactattgtattttcagaagacgataagaatgatatggatatc
actaagagttatacaatagaaataaaccatagacctttattagagaaacgtgattgtcat
ttggtgccattggcaggaacttctgaaactattttatatacatgtaggcaggatgacatg
gagatcactagaagtcacacaactgccttagaatgtaaaactgtctcaccagatgaaata
actactaggcctatggacaaaactgtagtgtttgtagataatcatgttgaactagaaatg
acagagtcccatactgttttcattgactaccaagaaaaggaaagaacagacagacctaac
tttgaactatcccaaaggaaaagcctaggaacaccaacagtgatatgtactcctactgag
gagagtgttttctttccaggaaatggtgaaagtgaccgtctagtagcaaatgacagccag
ctaacccctctggaggaatggtctaataataggggccctgtagaggtagctgataacatg
gaattgtctaaatcagccacttgcaaaaacatcaaagatgtacaaagtcctggatttctg
aatgaacctctatcaagcaaaagtcagagaagaaaaagccttaagctaaaaaatgacaag
accattgtattttcagagaatcataaaaatgatatggatattacccagagttgtatggtg
gaaatagataacgaaagtgccctggaggataaagaggacttccatttggcaggggcttct
aaaactattttgtattcatgtgggcaggatgacatggagatcactaggagtcacacaact
gccttagaatgtaaaactctcctgccaaatgaaatagctattaggcccatggacaaaacc
gtattgttcacagataattacagtgatctggaagtcaccgattcccatactgttttcatt
gactgtcaagccacagagaaaatacttgaagaaaaccctaaatttggaataggaaaagga
aaaaacttgggtgtttcctttcctaaggataatagctgtgttcaagaaatcgctgaaaaa
caagcactggctgtaggaaacaaaatagttcttcacaccgagcaaaagcaacaactcttt
gctgctactaatagaactactaatgaaatcatcaaatttcatagtgctgctatggatgaa
aaggtcatagggaaagttgtagaccaggcctgtacattggaaaaagcgcaagttgaaagc
tgtcagttaaataatagagatagaagaaatgtggactttacaagtagtcatgcaactgct
gtttgtggatccagtgataattattcctgtttaccaaatgttatttcctgtactgataat
ttggagggtagtgccatgctcttatgtgataaagatgaggaaaaagccaattattgccca
gtgcaaaatgatcttgcttatgcaaatgattttgccagtgaatattacttggaatctgag
ggacagcctctctctgctccttgtcctttgttagagaaggaagaagttattcaaaccagt
accaaaggacagttagactgtgttataacactgcacaaagatcaagatctgattaaggat
ccacgaaatctattggctaatcaaactttagtatatagtcaagatctgggggagatgact
aaacttaattcaaagcgagtatcttttaagcttccaaaggatcaaatgaaagtctatgtt
gatgacatttatgttattcctcagcctcatttctcaaccgaccaacctccattacctaaa
aaaggacagagtagtatcaataaagaagaagtaatactgtctaaagctggaaataagagt
ttaaatattatagaaaattcctctgcacccatatgtgaaaacaagcccaaaatactcaat
agtgaggaatggtttgctgcagcctgtaaaaaagaactgaaggaaaatattcaaacaact
aactataatacagctctagatttccacagtaactcagacgtaactaagcaagtcattcaa
actcatgtcaatgctggagaagcaccagatcctgtaattacatctaatgttccatgtttt
catagtatcaaaccaaatctgaataatttgaatggaaaaactggagagtttttagccttt
caaactgttcatctaccaccccttccagagcaattacttgaattaggaaataaggcacac
aatgatatgcatatagtgcaagctacagaaatacataatattaacataatctccagcaat
gctaaagatagtagagatgaggaaaataaaaagtctcataatggagctgaaaccacctct
ctaccgccaaagacagtttttaaagataaagtaaggagatgttctttgggaatctttttg
cctagattgcccaacaagagaaattgtagtgtcactggtattgatgacctggaacagatt
ccagcagacacaactgatataaatcacttagaaactcagccggtctctagcaaagattca
ggcattggatctgttgcaggtaaactgaacctaagtccttctcaatatataaatgaggaa
aatcttcctgtatatcctgatgagatcaattcttcagactctattaacatagaaactgag
gaaaaggccttgattgagacataccaaaaagagatttcaccatatgaaaataaaatggga
aaaacttgcaatagccaaaaaagaacgtgggtacaagaagaagaagatattcataaggag
aaaaaaatcagaaaaaatgagattaagtttagtgatacgacacaagatcgggagattttt
gatcaccatactgaagaggatatagataaaagtgctaacagtgtattgataaaaaacctg
agcaggaccccatctagttgcagcagctctctggattcaatcaaggctgatgggacctct
ctggacttcagcacttaccgcagtagtcaaatggaatcacagtttctcagagatactatt
tgtgaagagagcttgagggagaaactccaagatgggagaataacaataagggagttcttt
atacttctccaggtccacatcttgatacagaaaccccgacagagcaatctcccaggcaat
tttactgtaaacacaccacctactccagaagacctgatgttaagtcaatatgtttaccga
cccaagatacagatttatagagaagattgtgaggctcgtcgccaaaagattgaagaatta
aagctttctgcatcgaaccaagataagctgttggttgatataaataagaacctgtgggaa
aaaatgagacactgctctgacaaagagctgaaggcctttggaatttatcttaacaaaata
aagtcatgttttaccaagatgactaaagtcttcactcaccaaggaaaagtggctctgtat
ggcaagctggtgcagtcagctcagaatgagagggagaaacttcaaataaagatagatgag
atggataaaatacttaagaagatcgataactgcctcactgagatggaaacagaaactaag
aatttggaggatgaagagaaaaacaatcctgtggaagaatgggattctgaaatgagagct
gcagaaaaagaattggaacagctgaaaactgaagaagaggagcttcaaagaaatctctta
gaactggaggtacaaaaagagcagacccttgctcaaatagactttatgcaaaaacaaaga
aatagaactgaagagctactggatcagttgagcttgtctgagtgggatgtcgttgagtgg
agtgatgatcaagctgtattcacctttgtttatgacacgatacaactcaccatcaccttt
gaagagtcagttgttggtttccctttcctggacaagcgttataggaagattgttgatgtc
aattttcaatctctgttagatgaggatcaagctcctccttcctcccttttagttcataag
cttattttccagtacgttgaagaaaaggaatcctggaagaagacatgtacaacccagcat
cagttacccaagatgcttgaagaattctcactggtagtgcaccattgcagactccttgga
gaggagattgagtatttaaagagatggggaccaaattataacctaatgaacatagatatt
aataataatgaattgagacttttattctctagctccgcagcatttgcaaagtttgaaata
actttgtttctctcagcctattatccatctgtaccattaccttccaccattcagaatcac
gttgggaacactagccaagatgatattgctaccattctatctaaagtgccactggagaac
aactacctgaagaatgtagtcaagcaaatttaccaagatctgtttcaggactgccatttc
taccactag

DBGET integrated database retrieval system