KEGG   Homo sapiens (human): 57085Help
Entry
57085             CDS       T01001                                 

Gene name
AGTRAP, ATRAP
Definition
(RefSeq) angiotensin II receptor associated protein
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: AGTRAP
Motif
Other DBs
NCBI-GeneID: 57085
NCBI-ProteinID: NP_065083
OMIM: 608729
HGNC: 13539
Ensembl: ENSG00000177674
Vega: OTTHUMG00000002230
Pharos: Q6RW13(Tbio)
UniProt: Q6RW13
Position
1p36.22
AA seq 159 aa AA seqDB search
MELPAVNLKVILLGHWLLTTWGCIVFSGSYAWANFTILALGVWAVAQRDSIDAISMFLGG
LLATIFLDIVHISIFYPRVSLTDTGRFGVGMAILSLLLKPLSCCFVYHMYRERGGELLVH
TGFLGSSQDRSAYQTIDSAEAPADPFAVPEGRSQDARGY
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atggagctgcctgctgtgaacctgaaggtgattctcctaggtcactggctgctgacaacc
tggggctgcattgtattctcaggctcctatgcctgggccaacttcaccatcctggccttg
ggcgtgtgggctgtggctcagcgggactccatcgacgccataagcatgtttctgggtggc
ttgctggccaccatcttcctggacatcgtgcacatcagcatcttctacccgcgggtcagc
ctcacggacacgggccgctttggcgtgggcatggccatcctcagcttgctgctcaagccg
ctctcctgctgcttcgtctaccacatgtaccgggagcgcgggggtgagctcctggtccac
actggtttccttgggtcttctcaggaccgtagtgcctaccagacgattgactcagcagag
gcgcccgcagatccctttgcagtcccagagggcaggagtcaagatgcccgagggtactga

DBGET integrated database retrieval system