KEGG   Homo sapiens (human): 57091
Entry
57091             CDS       T01001                                 
Symbol
CASS4, C20orf32, CAS4, HEFL, HEPL
Name
(RefSeq) Cas scaffold protein family member 4
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: Serine_rich CAS_C SH3_9 SH3_1 SH3_2 LANC_like USP8_interact
Other DBs
NCBI-GeneID: 57091
NCBI-ProteinID: NP_001157588
OMIM: 618888
HGNC: 15878
Ensembl: ENSG00000087589
Pharos: Q9NQ75(Tbio)
UniProt: Q9NQ75 B4DII4
Structure
Position
20:56412036..56460382
AA seq 786 aa
MKGTGIMDCAPKALLARALYDNCPDCSDELAFSRGDILTILEQHVPESEGWWKCLLHGRQ
GLAPANRLQILTEVAADRPCPPFLRGLEEAPASSEETYQVPTLPRPPTPGPVYEQMRSWA
EGPQPPTAQVYEFPDPPTSARIICEKTLSFPKQAILTLPRPVRASLPTLPSQVYDVPTQH
RGPVVLKEPEKQQLYDIPASPKKAGLHPPDSQASGQGVPLISVTTLRRGGYSTLPNPQKS
EWIYDTPVSPGKASVRNTPLTSFAEESRPHALPSSSSTFYNPPSGRSRSLTPQLNNNVPM
QKKLSLPEIPSYGFLVPRGTFPLDEDVSYKVPSSFLIPRVEQQNTKPNIYDIPKATSSVS
QAGKELEKAKEVSENSAGHNSSWFSRRTTSPSPEPDRLSGSSSDSRASIVSSCSTTSTDD
SSSSSSEESAKELSLDLDVAKETVMALQHKVVSSVAGLMLFVSRKWRFRDYLEANIDAIH
RSTDHIEESVREFLDFARGVHGTACNLTDSNLQNRIRDQMQTISNSYRILLETKESLDNR
NWPLEVLVTDSVQNSPDDLERFVMVARMLPEDIKRFASIVIANGRLLFKRNCEKEETVQL
TPNAEFKCEKYIQPPQRETESHQKSTPSTKQREDEHSSELLKKNRANICGQNPGPLIPQP
SSQQTPERKPRLSEHCRLYFGALFKAISAFHGSLSSSQPAEIITQSKLVIMVGQKLVDTL
CMETQERDVRNEILRGSSHLCSLLKDVALATKNAVLTYPSPAALGHLQAEAEKLEQHTRQ
FRGTLG
NT seq 2361 nt   +upstreamnt  +downstreamnt
atgaagggaacaggcatcatggactgtgcgcccaaggcactcctggccagggcactttat
gacaactgccctgactgctctgacgagctggctttcagcagaggggacatcctgaccatt
ctggagcaacacgtgccagaaagcgagggttggtggaagtgtttgctccatgggaggcaa
ggcctggcccctgccaaccgcctccaaatcctcacggaggtcgctgcagacaggccgtgc
cccccattcctgagaggcctggaagaagctcctgccagctcagaggagacctatcaggtg
cccactctaccccgccctcccactccaggccccgtttatgagcagatgaggagttgggcg
gaggggccccagccccctactgcccaagtctatgaattccccgaccctcccaccagtgcc
agaatcatctgtgaaaagactctcagctttccaaaacaggccatcctcacgcttcccaga
cctgtccgggcctcactgccgactctgccttcccaggtgtatgacgtgcctacccagcac
cggggccccgtggtcctgaaggagccagagaagcagcagttatatgacataccagccagc
cccaagaaggcaggactccatcccccagacagccaagcaagtgggcagggtgttcccctg
atatcagtgactaccttaagaagaggcggttacagcacattaccaaatcctcagaaatcg
gaatggatttatgacactccagtgtctccaggaaaggccagcgtcagaaacacgcctctc
accagctttgcggaagaatcaaggccccacgctctccccagttccagctccactttctac
aatcctccaagtggcagatccaggtccctcactccacaactgaataacaatgtgcccatg
cagaaaaaactcagccttccagaaattccttcttatggctttcttgtacccagaggcaca
tttcctttggatgaagatgtcagctacaaggttccttcaagctttctgattccccgagtg
gaacagcagaacaccaagcccaatatttatgacatccctaaagcaacgtcgagtgtttct
caggctgggaaggagctggagaaagccaaggaggtgtcagagaattccgcgggccataat
tcctcatggttctccagacggacaacttccccatctcctgaaccggacagattatcaggt
tccagttctgacagcagagctagcatcgtttcctcgtgctccaccacatccaccgacgac
tcctccagctcttcctcggaggagtcagcaaaggagctctccttggacctggatgtggcc
aaggagacagtgatggctctgcagcacaaggtggtcagctctgtcgctggcctgatgctc
tttgtcagcaggaagtggagattccgagactatctggaggccaacattgatgcaatccac
aggtccactgatcacatagaagaatctgtaagagaatttctggattttgcccgaggagtc
catgggactgcctgtaacctcactgacagtaaccttcagaacagaattcgggaccagatg
cagaccatctccaactcctaccgcatcctgcttgaaacaaaggaaagcttggataatcgc
aattggcctctggaagttcttgtgactgacagtgtccagaacagcccagatgaccttgag
aggtttgtcatggtggcacggatgcttccagaagacatcaagaggtttgcctccattgtc
attgccaatggaaggctcctttttaagcggaactgtgaaaaggaagagactgtgcagttg
accccaaatgcagaatttaagtgtgaaaaatacatccagcctccccaaagagaaactgaa
tcacaccaaaagagtaccccttccactaagcaaagggaagatgaacactcttctgaacta
ttaaagaaaaatagggcaaatatctgtggacagaatcctggccctcttatacctcagcct
tcgagtcaacagactcctgagaggaaaccccgcttatctgaacactgccggctctacttt
ggggcgctcttcaaagccatcagcgcatttcacggcagcctcagcagcagccagcccgcg
gagatcatcactcagagcaagctggtcatcatggtgggacagaagctggtggacacgctg
tgcatggagacccaggagagggacgtgcgcaacgagatcctccgtggcagcagtcacctc
tgcagcctgctcaaggacgtagcgctggccactaagaatgccgtgctcacgtaccccagc
cctgccgcgctggggcacctccaggcggaggctgagaagctggagcaacacacgcggcag
ttcagagggacactgggatga

DBGET integrated database retrieval system