KEGG   Homo sapiens (human): 5710Help
Entry
5710              CDS       T01001                                 

Gene name
PSMD4, AF, AF-1, ASF, MCB1, Rpn10, S5A, pUB-R5
Definition
(RefSeq) proteasome 26S subunit, non-ATPase 4
  KO
K03029  26S proteasome regulatory subunit N10
Organism
hsa  Homo sapiens (human)
Pathway
hsa03050  Proteasome
hsa05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    5710 (PSMD4)
 09160 Human Diseases
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    5710 (PSMD4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:hsa03051]
    5710 (PSMD4)
Proteasome [BR:hsa03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    non-ATPase subunits
     5710 (PSMD4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: VWA_2 VWA Ssl1 UIM RAP80_UIM
Motif
Other DBs
NCBI-GeneID: 5710
NCBI-ProteinID: NP_002801
OMIM: 601648
HGNC: 9561
Ensembl: ENSG00000159352
Vega: OTTHUMG00000012349
Pharos: P55036(Tbio)
UniProt: P55036
Structure
PDB: 

Position
1q21.3
AA seq 377 aa AA seqDB search
MVLESTMVCVDNSEYMRNGDFLPTRLQAQQDAVNIVCHSKTRSNPENNVGLITLANDCEV
LTTLTPDTGRILSKLHTVQPKGKITFCTGIRVAHLALKHRQGKNHKMRIIAFVGSPVEDN
EKDLVKLAKRLKKEKVNVDIINFGEEEVNTEKLTAFVNTLNGKDGTGSHLVTVPPGPSLA
DALISSPILAGEGGAMLGLGASDFEFGVDPSADPELALALRVSMEEQRQRQEEEARRAAA
ASAAEAGIATTGTEDSDDALLKMTISQQEFGRTGLPDLSSMTEEEQIAYAMQMSLQGAEF
GQAESADIDASSAMDTSEPAKEEDDYDVMQDPEFLQSVLENLPGVDPNNEAIRNAMGSLA
SQATKDGKKDKKEEDKK
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atggtgttggaaagcactatggtgtgtgtggacaacagtgagtatatgcggaatggagac
ttcttacccaccaggctgcaggcccagcaggatgctgtcaacatagtttgtcattcaaag
acccgcagcaaccctgagaacaacgtgggccttatcacactggctaatgactgtgaagtg
ctgaccacactcaccccagacactggccgtatcctgtccaagctacatactgtccaaccc
aagggcaagatcaccttctgcacgggcatccgcgtggcccatctggctctgaagcaccga
caaggcaagaatcacaagatgcgcatcattgcctttgtgggaagcccagtggaggacaat
gagaaggatctggtgaaactggctaaacgcctcaagaaggagaaagtaaatgttgacatt
atcaattttggggaagaggaggtgaacacagaaaagctgacagcctttgtaaacacgttg
aatggcaaagatggaaccggttctcatctggtgacagtgcctcctgggcccagtttggct
gatgctctcatcagttctccgattttggctggtgaaggtggtgccatgctgggtcttggt
gccagtgactttgaatttggagtagatcccagtgctgatcctgagctggccttggccctt
cgtgtatctatggaagagcagcggcagcggcaggaggaggaggcccggcgggcagctgca
gcttctgctgctgaggccgggattgctacgactgggactgaagactcagacgatgccctg
ctgaagatgaccatcagccagcaagagtttggccgcactgggcttcctgacctaagcagt
atgactgaggaagagcagattgcttatgccatgcagatgtccctgcagggagcagagttt
ggccaggcggaatcagcagacattgatgccagctcagctatggacacatctgagccagcc
aaggaggaggatgattacgacgtgatgcaggaccccgagttccttcagagtgtcctagag
aacctcccaggtgtggatcccaacaatgaagccattcgaaatgctatgggctccctggcc
tcccaggccaccaaggacggcaagaaggacaagaaggaggaagacaagaagtga

DBGET integrated database retrieval system