KEGG   Homo sapiens (human): 57103Help
Entry
57103             CDS       T01001                                 

Gene name
TIGAR, C12orf5, FR2BP
Definition
(RefSeq) TP53 induced glycolysis regulatory phosphatase
  KO
K14634  fructose-2,6-bisphosphatase [EC:3.1.3.46]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00051  Fructose and mannose metabolism
hsa05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    57103 (TIGAR)
 09160 Human Diseases
  09161 Cancers: Overview
   05230 Central carbon metabolism in cancer
    57103 (TIGAR)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.46  fructose-2,6-bisphosphate 2-phosphatase
     57103 (TIGAR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-GeneID: 57103
NCBI-ProteinID: NP_065108
OMIM: 610775
HGNC: 1185
Ensembl: ENSG00000078237
Vega: OTTHUMG00000168124
Pharos: Q9NQ88(Tbio)
UniProt: Q9NQ88
Structure
PDB: 

Position
12p13.32
AA seq 270 aa AA seqDB search
MARFALTVVRHGETRFNKEKIIQGQGVDEPLSETGFKQAAAAGIFLNNVKFTHAFSSDLM
RTKQTMHGILERSKFCKDMTVKYDSRLRERKYGVVEGKALSELRAMAKAAREECPVFTPP
GGETLDQVKMRGIDFFEFLCQLILKEADQKEQFSQGSPSNCLETSLAEIFPLGKNHSSKV
NSDSGIPGLAASVLVVSHGAYMRSLFDYFLTDLKCSLPATLSRSELMSVTPNTGMSLFII
NFEEGREVKPTVQCICMNLQDHLNGLTETR
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atggctcgcttcgctctgactgttgtccggcatggagaaacaagatttaacaaggagaaa
ataatccaaggacaaggagtagatgaacctctttcagaaactggatttaaacaagcagca
gctgctggtatatttctgaataatgtgaagtttactcatgctttctccagtgatctcatg
aggacaaagcagaccatgcatggaattttggagagaagcaaattttgcaaagatatgacg
gtaaagtatgactcaagacttcgggaaaggaaatacggggttgtagaaggcaaagcgcta
agtgagctgagggccatggccaaagcagccagggaagagtgccctgtgtttacaccgccc
ggaggagagacgctggaccaggtgaaaatgcgtggaatagacttttttgaatttctttgt
caactaatcctgaaagaagcggatcaaaaagaacagttttcccaaggatctccaagcaac
tgtctggaaacttctttggcagagatatttcctttaggaaaaaatcacagctctaaagtt
aattcagacagcggtattccaggattagcagccagtgtcttagttgtgagtcacggtgct
tacatgagaagtctgtttgattattttctgactgaccttaagtgttccttaccagccact
ctgagcagatctgaacttatgtcagtcactcccaatacagggatgagtctctttatcata
aactttgaggaaggaagagaagttaaaccaacggttcagtgtatttgtatgaacctacag
gatcatctaaatggactgactgaaactcgctaa

DBGET integrated database retrieval system