KEGG   Homo sapiens (human): 57117
Entry
57117             CDS       T01001                                 

Gene name
INTS12, INT12, PHF22, SBBI22
Definition
(RefSeq) integrator complex subunit 12
  KO
K13149  integrator complex subunit 12
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hsa03041]
    57117 (INTS12)
Spliceosome [BR:hsa03041]
 Other splicing related proteins
  Proteins involved in snRNP biogenesis
   Integrator complex
    57117 (INTS12)
SSDB
Motif
Pfam: PHD C1_1 Prok-RING_1 zf-PHD-like PHD_4 zf-RING_9 PHD_2 zinc_ribbon_15 FYVE_2
Other DBs
NCBI-GeneID: 57117
NCBI-ProteinID: NP_001135943
OMIM: 611355
HGNC: 25067
Ensembl: ENSG00000138785
Vega: OTTHUMG00000131215
Pharos: Q96CB8(Tdark)
UniProt: Q96CB8 A0A024RDK4
Position
4q24
AA seq 462 aa
MAATVNLELDPIFLKALGFLHSKSKDSAEKLKALLDESLARGIDSSYRPSQKDVEPPKIS
STKNISIKQEPKISSSLPSGNNNGKVLTTEKVKKEAEKRPADKMKSDITEGVDIPKKPRL
EKPETQSSPITVQSSKDLPMADLSSFEETSADDFAMEMGLACVVCRQMMVASGNQLVECQ
ECHNLYHRDCHKPQVTDKEANDPRLVWYCARCTRQMKRMAQKTQKPPQKPAPAVVSVTPA
VKDPLVKKPETKLKQETTFLAFKRTEVKTSTVISGNSSSASVSSSVTSGLTGWAAFAAKT
SSAGPSTAKLSSTTQNNTGKPATSSANQKPVGLTGLATSSKGGIGSKIGSNNSTTPTVPL
KPPPPLTLGKTGLSRSVSCDNVSKVGLPSPSSLVPGSSSQLSGNGNSGTSGPSGSTTSKT
TSESSSSPSASLKGPTSQESQLNAMKRLQMVKKKAAQKKLKK
NT seq 1389 nt   +upstreamnt  +downstreamnt
atggctgctactgtgaacttggaacttgatcccatttttttgaaagcactaggtttcttg
cattcaaagagtaaagattctgctgaaaagctaaaagcactgcttgatgaatctttggct
cggggcattgattccagttaccgtccatctcaaaaggatgtggagccacccaaaatttca
agcacaaaaaacatttccattaagcaagagcccaaaatatcatccagtcttccttctggt
aataataatggcaaggtcctcacaactgaaaaggtaaagaaggaagctgaaaagagacct
gctgataaaatgaaatcagacatcactgaaggagttgatattccaaagaaacctagattg
gagaaaccagaaacacagtcatctcccattactgtccaaagtagcaaggatttacctatg
gctgacctttccagttttgaggagaccagtgctgatgattttgccatggagatgggattg
gcctgcgttgtttgtaggcaaatgatggtggcatctggcaatcaattagtagaatgtcag
gagtgccataatctctaccaccgagattgtcataaaccccaggtgacagacaaggaagcg
aatgaccctcgcctggtgtggtattgtgcccgatgtaccagacaaatgaaaagaatggct
caaaaaactcagaaaccaccgcagaaaccagcccctgcagttgtttctgtaactccagct
gtcaaagatccattggttaagaaaccagaaactaaactgaaacaagagacaacttttcta
gcgtttaagagaacagaagtcaagacatccacagttatttcaggaaattcttctagtgcc
agcgtttcctcgtcagtaactagtggcttaactggatgggcagcttttgcagccaaaact
tcctctgctggtccttcaacagcaaaattgagttcaacaacacaaaacaatactgggaaa
cctgctacttcgtcagctaaccagaaacctgtgggtttgactggtctggcaacatcatcc
aaaggtggaataggttccaaaataggttccaataacagcactacgcccactgtaccttta
aaaccacctccacctctaaccttgggtaaaactggccttagtcgctcagttagttgtgac
aatgtcagcaaagtaggtcttcctagtccaagtagtttagttccaggaagcagcagccaa
ctaagtgggaatggaaatagtggaacatcaggacctagtggaagtactaccagcaaaact
acttcagaatccagcagctctccctcagcatcccttaaaggcccaacttcacaagaatca
cagctcaatgctatgaagcgattacagatggtcaagaagaaagctgcccaaaagaaactc
aagaagtaa

DBGET integrated database retrieval system