KEGG   Homo sapiens (human): 57120
Entry
57120             CDS       T01001                                 

Gene name
GOPC, CAL, FIG, GOPC1, PIST, dJ94G16.2
Definition
(RefSeq) golgi associated PDZ and coiled-coil motif containing
  KO
K24054   
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: PDZ PDZ_6 PDZ_2 bZIP_2 DUF903 bZIP_1 NPV_P10
Other DBs
NCBI-GeneID: 57120
NCBI-ProteinID: NP_065132
OMIM: 606845
HGNC: 17643
Ensembl: ENSG00000047932
Vega: OTTHUMG00000015457
Pharos: Q9HD26(Tbio)
UniProt: Q9HD26
Structure
PDB: 

Position
6q22.1
AA seq 462 aa
MSAGGPCPAAAGGGPGGASCSVGAPGGVSMFRWLEVLEKEFDKAFVDVDLLLGEIDPDQA
DITYEGRQKMTSLSSCFAQLCHKAQSVSQINHKLEAQLVDLKSELTETQAEKVVLEKEVH
DQLLQLHSIQLQLHAKTGQSADSGTIKAKLSGPSVEELERELEANKKEKMKEAQLEAEVK
LLRKENEALRRHIAVLQAEVYGARLAAKYLDKELAGRVQQIQLLGRDMKGPAHDKLWNQL
EAEIHLHRHKTVIRACRGRNDLKRPMQAPPGHDQDSLKKSQGVGPIRKVLLLKEDHEGLG
ISITGGKEHGVPILISEIHPGQPADRCGGLHVGDAILAVNGVNLRDTKHKEAVTILSQQR
GEIEFEVVYVAPEVDSDDENVEYEDESGHRYRLYLDELEGGGNPGASCKDTSGEIKVLQG
FNKKAVTDTHENGDLGTASETPLDDGASKLDDLHTLYHKKSY
NT seq 1389 nt   +upstreamnt  +downstreamnt
atgtcggcgggcggtccatgcccagcagcagccggagggggcccagggggcgcctcctgc
tccgtgggggcccctggcggggtatccatgttccggtggctggaggtgctggagaaggag
ttcgacaaagcttttgtggatgtggatctgctcctgggagagatcgatccagaccaagcg
gacatcacttatgaggggcgacagaagatgaccagcctgagctcctgctttgcacagctt
tgccacaaagcccagtctgtgtctcaaatcaaccacaagctggaggcacagttggtggat
ctgaaatctgaactgacagaaacccaagcagagaaagttgttttggagaaagaagtacat
gatcagcttttacagctgcactctattcagctgcagcttcatgctaaaactggtcaaagt
gctgactctggtaccattaaggcaaaattgtctggcccctctgtggaggagctggaaaga
gagcttgaggcaaacaaaaaagaaaaaatgaaagaagcacaacttgaagctgaagtgaaa
ttgttgagaaaagagaatgaagcccttcgtagacatatagctgttctccaggctgaagta
tatggggcgagactagctgccaagtacttggataaggaactggcaggaagggtccaacag
atacaattgctaggacgagatatgaagggacctgctcatgataagctttggaaccaatta
gaagctgaaatacatttgcatcgtcacaaaactgtgatccgagcctgcagaggacgtaat
gacttgaaacgaccaatgcaagcaccaccaggccatgatcaagattccctaaagaaaagc
caaggtgttggtccaattagaaaagttctcctccttaaggaagatcatgaaggccttggc
atttcaattacaggtgggaaagaacatggtgttccaatcctcatctctgagatccatccg
gggcaacctgctgatagatgcggagggctgcacgttggggatgctattttggcagtcaac
ggagttaacctaagggacacaaagcataaagaagctgtaactattctttctcagcagaga
ggagagattgaatttgaagtagtttatgtggctcctgaagtggattctgatgatgaaaac
gtagagtatgaagatgagagtggacatcgttaccgtttgtaccttgatgagttagaagga
ggtggtaaccctggtgctagttgcaaagacacaagtggggaaatcaaagtattacaagga
tttaataagaaggcagtaactgacacacatgaaaatggagacctgggcactgcaagtgaa
actccgctagatgacggtgcttcaaaattagatgatctgcacactctgtatcataaaaaa
tcttattaa

DBGET integrated database retrieval system