KEGG   Homo sapiens (human): 57130
Entry
57130             CDS       T01001                                 

Gene name
ATP13A1, ATP13A, CGI-152
Definition
(RefSeq) ATPase 13A1
  KO
K14950  manganese-transporting P-type ATPase [EC:7.2.2.-]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    57130 (ATP13A1)
SSDB
Motif
Pfam: E1-E2_ATPase Hydrolase Cation_ATPase Hydrolase_3
Other DBs
NCBI-GeneID: 57130
NCBI-ProteinID: NP_065143
HGNC: 24215
Ensembl: ENSG00000105726
Vega: OTTHUMG00000153016
Pharos: Q9HD20(Tdark)
UniProt: Q9HD20 A0A024R7N2
Position
19p13.11
AA seq 1204 aa
MAAAAAVGNAVPCGARPCGVRPDGQPKPGPQPRALLAAGPALIANGDELVAAVWPYRRLA
LLRRLTVLPFAGLLYPAWLGAAAAGCWGWGSSWVQIPEAALLVLATICLAHALTVLSGHW
SVHAHCALTCTPEYDPSKATFVKVVPTPNNGSTELVALHRNEGEDGLEVLSFEFQKIKYS
YDALEKKQFLPVAFPVGNAFSYYQSNRGFQEDSEIRAAEKKFGSNKAEMVVPDFSELFKE
RATAPFFVFQVFCVGLWCLDEYWYYSVFTLSMLVAFEASLVQQQMRNMSEIRKMGNKPHM
IQVYRSRKWRPIASDEIVPGDIVSIGRSPQENLVPCDVLLLRGRCIVDEAMLTGESVPQM
KEPIEDLSPDRVLDLQADSRLHVIFGGTKVVQHIPPQKATTGLKPVDSGCVAYVLRTGFN
TSQGKLLRTILFGVKRVTANNLETFIFILFLLVFAIAAAAYVWIEGTKDPSRNRYKLFLE
CTLILTSVVPPELPIELSLAVNTSLIALAKLYMYCTEPFRIPFAGKVEVCCFDKTGTLTS
DSLVVRGVAGLRDGKEVTPVSSIPVETHRALASCHSLMQLDDGTLVGDPLEKAMLTAVDW
TLTKDEKVFPRSIKTQGLKIHQRFHFASALKRMSVLASYEKLGSTDLCYIAAVKGAPETL
HSMFSQCPPDYHHIHTEISREGARVLALGYKELGHLTHQQAREVKREALECSLKFVGFIV
VSCPLKADSKAVIREIQNASHRVVMITGDNPLTACHVAQELHFIEKAHTLILQPPSEKGR
QCEWRSIDGSIVLPLARGSPKALALEYALCLTGDGLAHLQATDPQQLLRLIPHVQVFARV
APKQKEFVITSLKELGYVTLMCGDGTNDVGALKHADVGVALLANAPERVVERRRRPRDSP
TLSNSGIRATSRTAKQRSGLPPSEEQPTSQRDRLSQVLRDLEDESTPIVKLGDASIAAPF
TSKLSSIQCICHVIKQGRCTLVTTLQMFKILALNALILAYSQSVLYLEGVKFSDFQATLQ
GLLLAGCFLFISRSKPLKTLSRERPLPNIFNLYTILTVMLQFFVHFLSLVYLYREAQARS
PEKQEQFVDLYKEFEPSLVNSTVYIMAMAMQMATFAINYKGPPFMESLPENKPLVWSLAV
SLLAIIGLLLGSSPDFNSQFGLVDIPVEFKLVIAQVLLLDFCLALLADRVLQFFLGTPKL
KVPS
NT seq 3615 nt   +upstreamnt  +downstreamnt
atggcggcagcggcggcggtgggcaacgcggtgccctgcggggcccggccttgcggggtc
cggcctgacgggcagcccaagcccgggccgcagccgcgcgcgctccttgccgccgggccg
gcgctcatagcgaacggtgacgagctggtggctgccgtgtggccgtaccggcggttggcg
ctgttgcggcgcctcacggtgctgccattcgccgggctgctttacccggcctggttgggt
gccgcagccgctggctgctggggctggggcagcagttgggtgcagatccccgaagctgcg
ctgctcgtgcttgccaccatctgcctcgcgcacgcgctcactgtcctctcggggcattgg
tctgtgcacgcgcattgcgcgctcacctgcaccccggagtacgaccccagcaaagcgacc
tttgtgaaggtggtgccaacccccaacaatggctccacggagctcgtggccctgcaccgc
aatgagggcgaagacgggcttgaggtgctgtccttcgaattccagaagatcaagtattcc
tacgatgccctggagaagaagcagtttctccccgtggcctttcctgtgggaaacgccttc
tcatactatcagagcaacagaggcttccaggaagactcagagatccgagcagctgagaag
aaatttgggagcaacaaggccgagatggtggtgcctgacttctcggagcttttcaaggag
agagccacagcccccttctttgtatttcaggtgttctgtgtggggctctggtgcctggat
gagtactggtactacagcgtctttacgctatccatgctggtggcgttcgaggcctcgctg
gtgcagcagcagatgcggaacatgtcggagatccggaagatgggcaacaagccccacatg
atccaggtctaccgaagccgcaagtggaggcccattgccagtgatgagatcgtaccaggg
gacatcgtctccatcggccgctccccacaggagaacctggtgccatgtgacgtgcttctg
ctgcgaggccgctgcatcgtagacgaggccatgctcacgggggagtccgtgccacagatg
aaggagcccatcgaagacctcagcccagaccgggtgctggacctccaggctgattcccgg
ctgcacgtcatcttcgggggcaccaaggtggtgcagcacatccccccacagaaagccacc
acgggcctgaagccggttgacagcgggtgcgtggcctacgtcctgcggaccggattcaac
acatcccagggcaagctgctgcgcaccatcctcttcggggtcaagagggtgactgcgaac
aacctggagaccttcatcttcatcctcttcctcctggtgtttgccatcgctgcagctgcc
tatgtatggattgaaggtaccaaggaccccagccggaaccgctacaagctgtttctggag
tgcaccctgatcctcacctcggtcgtgcctcctgagctgcccatcgagctgtccctggcc
gtcaacacctccctcatcgccctggccaagctctacatgtactgcacagagcccttccgg
atcccctttgctggcaaggtcgaggtgtgctgctttgacaagacggggacgttgaccagt
gacagcctggtggtgcgcggtgtggccgggctgagagacgggaaggaggtgaccccagtg
tccagcatccctgtagaaacacaccgggccctggcctcgtgccactcgctcatgcagctg
gacgacggcaccctcgtgggtgaccctctagagaaggccatgctgacggccgtggactgg
acgctgaccaaagatgagaaagtattcccccgaagtattaaaactcaggggctgaaaatt
caccagcgctttcattttgccagtgccctgaagcgaatgtccgtgcttgcctcgtatgag
aagctgggctccaccgacctctgctacatcgcggccgtgaagggggcccccgaaactctg
cactccatgttctcccagtgcccgcccgactaccaccacatccacaccgagatctcccgg
gaaggagcccgcgtcctggcgctggggtacaaggagctgggacacctcactcaccagcag
gcccgggaggtcaagcgggaggccctggagtgcagcctcaagttcgtcggcttcattgtg
gtctcctgcccgctcaaggctgactccaaggccgtgatccgggagatccagaatgcgtcc
caccgggtggtcatgatcacgggagacaacccgctcactgcatgccacgtggcccaggag
ctgcacttcattgaaaaggcccacacgctgatcctgcagcctccctccgagaaaggccgg
cagtgcgagtggcgctccattgacggcagcatcgtgctgcccctggcccggggctcccca
aaggcactggccctggagtacgcactgtgcctcacaggcgacggcttggcccacctgcag
gccaccgacccccagcagctgctccgcctcatcccccatgtgcaggtgttcgcccgtgtg
gctcccaagcagaaggagtttgtcatcaccagcctgaaggagctgggctacgtgaccctc
atgtgtggggatggcaccaacgacgtgggcgccctgaagcatgctgacgtgggtgtggcg
ctcttggccaatgcccctgagcgggttgtcgagcggcgacggcggccccgggacagccca
accctgagcaacagtggcatcagagccacctccaggacagccaagcagcggtcggggctc
cctccctccgaggagcagccaacctcccagagggaccgcctgagccaggtgctgcgagac
ctcgaggacgagagtacgcccattgtgaaactgggggatgccagcatcgcagcacccttc
acctccaagctctcatccatccagtgcatctgccacgtgatcaagcagggccgctgcacg
ctggtgaccacgctacagatgttcaagatcctggcgctcaatgccctcatcctggcctac
agccagagcgtcctctacctggagggagtcaagttcagtgacttccaggccaccctacag
gggctgctgctggccggctgcttcctcttcatctcccgttccaagcccctcaagaccctc
tcccgagaacggcccctgcccaacatcttcaacctgtacaccatcctcaccgtcatgctc
cagttctttgtgcacttcctgagccttgtctacctgtaccgtgaggcccaggcccggagc
cccgagaagcaggagcagttcgtggacttgtacaaggagtttgagccaagcctggtcaac
agcaccgtctacatcatggccatggccatgcagatggccaccttcgccatcaattacaaa
ggcccgcccttcatggagagcctgcccgagaacaagcccctggtgtggagtctggcagtt
tcactcctggccatcattggcctgctcctcggctcctcgcccgacttcaacagccagttt
ggcctcgtggacatccctgtggagttcaagctggtcattgcccaggtcctgctcctggac
ttctgcctggcgctcctggccgaccgcgtcctgcagttcttcctggggaccccgaagctg
aaagtgccttcctga

DBGET integrated database retrieval system