KEGG   Homo sapiens (human): 57134
Entry
57134             CDS       T01001                                 

Gene name
MAN1C1, HMIC, MAN1A3, MAN1C, pp6318
Definition
(RefSeq) mannosidase alpha class 1C member 1
  KO
K01230  mannosyl-oligosaccharide alpha-1,2-mannosidase [EC:3.2.1.113]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00510  N-Glycan biosynthesis
hsa00513  Various types of N-glycan biosynthesis
hsa01100  Metabolic pathways
hsa04141  Protein processing in endoplasmic reticulum
Module
hsa_M00073  N-glycan precursor trimming
Network
nt06015  N-Glycan biosynthesis
  Element
N00820  N-Glycan biosynthesis
N00821  B4GALT1 deficiency in N-glycan biosynthesis
N00822  MGAT2 deficiency in N-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    57134 (MAN1C1)
   00513 Various types of N-glycan biosynthesis
    57134 (MAN1C1)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    57134 (MAN1C1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    57134 (MAN1C1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.113  mannosyl-oligosaccharide 1,2-alpha-mannosidase
     57134 (MAN1C1)
Membrane trafficking [BR:hsa04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   ER-Golgi intermediate compartment (ERGIC) proteins
    57134 (MAN1C1)
SSDB
Motif
Pfam: Glyco_hydro_47
Other DBs
NCBI-GeneID: 57134
NCBI-ProteinID: NP_065112
OMIM: 616772
HGNC: 19080
Ensembl: ENSG00000117643
Vega: OTTHUMG00000004417
Pharos: Q9NR34(Tdark)
UniProt: Q9NR34 Q59G34
Position
1p36.11
AA seq 630 aa
MLMRKVPGFVPASPWGLRLPQKFLFLLFLSGLVTLCFGALFLLPHSSRLKRLFLAPRTQQ
PGLEVVAEIAGHAPAREQEPPPNPAPAAPAPGEDDPSSWASPRRRKGGLRRTRPTGPREE
ATAARGNSIPASRPGDEGVPFRFDFNAFRSRLRHPVLGTRADESQEPQSQVRAQREKIKE
MMQFAWQSYKRYAMGKNELRPLTKDGYEGNMFGGLSGATVIDSLDTLYLMELKEEFQEAK
AWVGESFHLNVSGEASLFEVNIRYIGGLLSAFYLTGEEVFRIKAIRLGEKLLPAFNTPTG
IPKGVVSFKSGNWGWATAGSSSILAEFGSLHLEFLHLTELSGNQVFAEKVRNIRKVLRKI
EKPFGLYPNFLSPVSGNWVQHHVSVGGLGDSFYEYLIKSWLMSGKTDMEAKNMYYEALEA
IETYLLNVSPGGLTYIAEWRGGILDHKMGHLACFSGGMIALGAEDAKEEKRAHYRELAAQ
ITKTCHESYARSDTKLGPEAFWFNSGREAVATQLSESYYILRPEVVESYMYLWRQTHNPI
YREWGWEVVLALEKYCRTEAGFSGIQDVYSSTPNHDNKQQSFFLAETLKYLYLLFSEDDL
LSLEDWVFNTEAHPLPVNHSDSSGRAWGRH
NT seq 1893 nt   +upstreamnt  +downstreamnt
atgctcatgaggaaagtgcccggcttcgtcccggcctccccgtgggggctgcggctgccg
cagaagttcctcttcctcctcttcctctcgggcctggtcaccctgtgcttcggggccctc
ttcctgctgccccactcctctcgcctcaagcgcctcttcctggccccccggacccagcag
cctggtctggaagtggtggctgaaatcgccggccatgccccggcccgcgagcaggagccg
cctcccaacccggcccccgccgcgccggccccgggcgaggatgaccccagcagctgggcc
agtccccgccgcaggaaaggggggctgcggcgcacccgccccactggaccccgcgaggag
gccacggcggcccggggcaatagcatcccggcctccaggcccggggacgagggcgtccct
ttccgctttgacttcaacgcattccggagccgtctccgccacccggtcctgggaacgagg
gccgatgagagtcaggagccccagagccaagtgcgagcccagcgggagaaaatcaaggag
atgatgcagtttgcttggcagagctataagcgttatgcaatggggaaaaacgaactccgt
ccactaacaaaagatggctacgagggtaacatgttcggaggcctcagcggggcaacagtc
attgactccctcgataccctctacctcatggagctgaaggaggagttccaggaggccaag
gcctgggtgggagagagcttccacctgaacgtgagcggagaagcatccttgtttgaggtg
aacatccgctacatcgggggactcctctcagccttctacctgacaggagaagaggtgttc
cgaataaaggccatcaggctgggagagaagctcctgccggcgttcaacacccccacggga
atcccaaagggcgtggtgagcttcaaaagtgggaactggggctgggccacagccggcagc
agcagcatcttggcggagtttggatccctgcacttggaattcttacacctcactgaactc
tctggcaaccaggtcttcgctgaaaaggtcaggaacatccgcaaggtcctcaggaagatc
gaaaagccctttggcctctaccccaacttcctcagcccagtgagtgggaactgggtgcaa
caccatgtctcagttggaggactcggggacagtttttatgaatatttgatcaaatcctgg
ttgatgtcgggcaagacagatatggaggctaaaaatatgtactacgaagccttggaggcg
atagagacctacttgctgaatgtctctcccggggggctgacctacattgccgagtggcga
ggggggattctggaccacaagatggggcacctggcctgtttctccgggggcatgatcgcc
cttggcgccgaggatgccaaggaagaaaagagggcccactaccgagagctcgcagcccag
atcaccaagacgtgtcacgagtcatacgcccgctcagacaccaaacttgggcctgaggcc
ttctggtttaactccggcagagaggccgtggccacccagctgagcgagagctactacatc
ctccggccagaggtggtggagagctacatgtacctgtggcgacagacccacaaccccatc
tacagggagtggggctgggaggtggtgctggccttggagaaatactgtcggacagaagcc
ggtttctctgggatccaagacgtgtacagtagcacccccaaccacgacaacaagcagcag
agcttctttctagcggagacactaaagtatctctatcttctgttctctgaagatgacttg
ctctccctggaagactgggtgttcaacaccgaggcccacccactcccggtgaaccactca
gacagctccggcagagcctggggcagacactga

DBGET integrated database retrieval system