KEGG   Homo sapiens (human): 57135Help
Entry
57135             CDS       T01001                                 

Gene name
DAZ4, pDP1680, pDP1681
Definition
(RefSeq) deleted in azoospermia 4
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: RRM_1 RRM_5 RRM_7
Motif
Other DBs
NCBI-GeneID: 57135
NCBI-ProteinID: NP_001005375
OMIM: 400048
HGNC: 15966
Ensembl: ENSG00000205916
Vega: OTTHUMG00000045100
Pharos: Q86SG3(Tbio)
UniProt: Q86SG3 Q658T2
Position
Yq11.23
AA seq 579 aa AA seqDB search
MSAANPETPNSTISREASTQSSSAAASQGWVLPEGKIVPNTVFVGGIDARMDETEIGSCF
GRYGSVKEVKIITNRTGVSKGYGFVSFVNDVDVQKIVGSQIHFHGKKLKLGPAIRKQKLC
ARHVQPRPLVVNPPPPPQFQNVWRNPNTETYLQPQITPNPVTQHVQSAANPETPNSTISR
EASTQSSSAAASQGWVLPEGKIVPNTVFVGGIDARMDETEIGSCFGRYGSVKEVKIITNR
TGVSKGYGFVSFVNDVDVQKIVGSQIHFHGKKLKLGPAIRKQKLCARHVQPRPLVVNPPP
PPQFQNVWRNPNTETYLQPQITPNPVTQHVQAYSAYPHSPGQVITGCQLLVYNYQEYPTY
PDSAFQVTTGYQLPVYNYQPFPAYPRSPFQVTAGYQLPVYNYQAFPAYPNSPFQVATGYQ
FPVYNYQPFPAYPSSPFQVTAGYQLPVYNYQAFPAYPNSPFQVATGYQFPVYNYQAFPAY
PNSPVQVTTGYQLPVYNYQAFPAYPSSPFQVTTGYQLPVYNYQAFPAYPNSAVQVTTGYQ
FHVYNYQMPPQCPVGEQRRNLWTEAYKWWYLVCLIQRRD
NT seq 1740 nt NT seq  +upstreamnt  +downstreamnt
atgtctgctgcaaatcctgagactccaaactcaaccatctccagagaggccagcacccag
tcttcatcagctgcagctagccaaggctgggtgttaccagaaggcaaaatcgtgccaaac
actgtttttgttggtggaattgatgctaggatggatgaaactgagattggaagctgcttt
ggtagatacggttcagtgaaagaagtgaagataatcacgaatcgaactggtgtgtccaaa
ggctatggatttgtttcgtttgttaatgacgtggatgtccagaagatagtaggatcacag
atacatttccatggtaaaaagctgaagctgggccctgcaatcaggaaacaaaagttatgt
gctcgtcatgtgcagccacgtcctttggtagttaatcctcctcctccaccacagtttcag
aacgtctggcggaatccaaacactgaaacctacctgcagccccaaatcacgccgaatcct
gtaactcagcacgttcagtctgctgcaaatcctgagactccaaactcaaccatctccaga
gaggccagcacccagtcttcatcagctgcagctagccaaggctgggtgttaccagaaggc
aaaatcgtgccaaacactgtttttgttggtggaattgatgctaggatggatgaaactgag
attggaagctgctttggtagatacggttcagtgaaagaagtgaagataatcacgaatcga
actggtgtgtccaaaggctatggatttgtttcgtttgttaatgacgtggatgtccagaag
atagtaggatcacagatacatttccatggtaaaaagctgaagctgggccctgcaatcagg
aaacaaaagttatgtgctcgtcatgtgcagccacgtcctttggtagttaatcctcctcct
ccaccacagtttcagaacgtctggcggaatccaaacactgaaacctacctgcagccccaa
atcacgccgaatcctgtaactcagcacgttcaggcttactctgcttatccacattcacca
ggtcaggtcatcactggatgtcagttgcttgtatataattatcaggaatatcctacttat
cccgattcagcatttcaggtcaccactggatatcagttgcctgtatataattatcagcca
tttcctgcttatccaagatcaccatttcaggtcactgctggatatcagttgcctgtatat
aattatcaggcatttcctgcttatccaaattcaccatttcaagtcgccactggatatcag
ttccctgtatacaattatcagccatttcctgcttatccaagttcaccatttcaggtcact
gctggatatcagttgcctgtatataattatcaggcatttcctgcttatccaaattcacca
tttcaagtcgccactggatatcagttccctgtatacaattatcaggcatttcctgcttat
ccaaattcaccagttcaggtcaccactggatatcagttgcctgtatacaattatcaggca
tttcctgcttatccaagttcaccatttcaggtcaccactggatatcagttgcctgtatat
aattatcaggcatttcctgcttatccaaattcagcagttcaggtcaccactggatatcag
ttccatgtatacaattaccagatgccaccgcagtgccctgttggggagcaaaggagaaat
ctgtggaccgaagcatacaaatggtggtatcttgtctgtttaatccagagaagagactga

DBGET integrated database retrieval system