KEGG   Homo sapiens (human): 57136
Entry
57136             CDS       T01001                                 

Gene name
APMAP, BSCv, C20orf3
Definition
(RefSeq) adipocyte plasma membrane associated protein
  KO
K21407  adipocyte plasma membrane-associated protein
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    57136 (APMAP)
Membrane trafficking [BR:hsa04131]
 Others
  Rab GTPases of specific organelles
   Lipid droplets
    57136 (APMAP)
SSDB
Motif
Pfam: Str_synth SGL NHL Arylesterase
Other DBs
NCBI-GeneID: 57136
NCBI-ProteinID: NP_065392
OMIM: 615884
HGNC: 13238
Ensembl: ENSG00000101474
Vega: OTTHUMG00000032107
Pharos: Q9HDC9(Tbio)
UniProt: Q9HDC9
Position
20p11.21
AA seq 416 aa
MSEADGLRQRRPLRPQVVTDDDGQAPEAKDGSSFSGRVFRVTFLMLAVSLTVPLLGAMML
LESPIDPQPLSFKEPPLLLGVLHPNTKLRQAERLFENQLVGPESIAHIGDVMFTGTADGR
VVKLENGEIETIARFGSGPCKTRDDEPVCGRPLGIRAGPNGTLFVADAYKGLFEVNPWKR
EVKLLLSSETPIEGKNMSFVNDLTVTQDGRKIYFTDSSSKWQRRDYLLLVMEGTDDGRLL
EYDTVTREVKVLLDQLRFPNGVQLSPAEDFVLVAETTMARIRRVYVSGLMKGGADLFVEN
MPGFPDNIRPSSSGGYWVGMSTIRPNPGFSMLDFLSERPWIKRMIFKLFSQETVMKFVPR
YSLVLELSDSGAFRRSLHDPDGLVATYISEVHEHDGHLYLGSFRSPFLCRLSLQAV
NT seq 1251 nt   +upstreamnt  +downstreamnt
atgagcgaggcggacgggctgcgacagcgccggcccctgcggccgcaggtcgtcacagac
gatgatggccaggccccggaggctaaggacggcagctcctttagcggcagagttttccga
gtgaccttcttgatgctggctgtttctctcaccgttcccctgcttggagccatgatgctg
ctggaatctcctatagatccacagcctctcagcttcaaagaacccccgctcttgcttggt
gttctgcatccaaatacgaagctgcgacaggcagaaaggctgtttgaaaatcaacttgtt
ggaccggagtccatagcacatattggggatgtgatgtttactgggacagcagatggccgg
gtcgtaaaacttgaaaatggtgaaatagagaccattgcccggtttggttcgggcccttgc
aaaacccgagatgatgagcctgtgtgtgggagacccctgggtatccgtgcagggcccaat
gggactctctttgtggccgatgcatacaagggactatttgaagtaaatccctggaaacgt
gaagtgaaactgctgctgtcctccgagacacccattgaggggaagaacatgtcctttgtg
aatgatcttacagtcactcaggatgggaggaagatttatttcaccgattctagcagcaaa
tggcaaagacgagactacctgcttctggtgatggagggcacagatgacgggcgcctgctg
gagtatgatactgtgaccagggaagtaaaagttttattggaccagctgcggttcccgaat
ggagtccagctgtctcctgcagaagactttgtcctggtggcagaaacaaccatggccagg
atacgaagagtctacgtttctggcctgatgaagggcggggctgatctgtttgtggagaac
atgcctggatttccagacaacatccggcccagcagctctggggggtactgggtgggcatg
tcgaccatccgccctaaccctgggttttccatgctggatttcttatctgagagaccctgg
attaaaaggatgatttttaagctctttagtcaagagacggtgatgaagtttgtgccgcgg
tacagcctcgtcctagaactcagcgacagcggtgccttccggagaagcctgcatgatccc
gatgggctggtggccacctacatcagcgaggtgcacgaacacgatgggcacctgtacctg
ggctctttcaggtcccccttcctctgcagactcagcctccaggctgtttag

DBGET integrated database retrieval system