KEGG   Homo sapiens (human): 57142
Entry
57142             CDS       T01001                                 
Symbol
RTN4, ASY, NI220/250, NOGO, NSP, NSP-CL, Nbla00271, Nbla10545, RTN-X, RTN4-A, RTN4-B1, RTN4-B2, RTN4-C
Name
(RefSeq) reticulon 4
  KO
K20720  reticulon-4
Organism
hsa  Homo sapiens (human)
Pathway
hsa05010  Alzheimer disease
Drug target
Ozanezumab: D10331
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    57142 (RTN4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    57142 (RTN4)
   03036 Chromosome and associated proteins [BR:hsa03036]
    57142 (RTN4)
Membrane trafficking [BR:hsa04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Others
   Others
    57142 (RTN4)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation proteins
   Spindle formation proteins
    57142 (RTN4)
SSDB
Motif
Pfam: Reticulon DUF639
Other DBs
NCBI-GeneID: 57142
NCBI-ProteinID: NP_065393
OMIM: 604475
HGNC: 14085
Ensembl: ENSG00000115310
Pharos: Q9NQC3(Tbio)
UniProt: Q9NQC3
Structure
Position
2:complement(54972189..55137831)
AA seq 1192 aa
MEDLDQSPLVSSSDSPPRPQPAFKYQFVREPEDEEEEEEEEEEDEDEDLEELEVLERKPA
AGLSAAPVPTAPAAGAPLMDFGNDFVPPAPRGPLPAAPPVAPERQPSWDPSPVSSTVPAP
SPLSAAAVSPSKLPEDDEPPARPPPPPPASVSPQAEPVWTPPAPAPAAPPSTPAAPKRRG
SSGSVDETLFALPAASEPVIRSSAENMDLKEQPGNTISAGQEDFPSVLLETAASLPSLSP
LSAASFKEHEYLGNLSTVLPTEGTLQENVSEASKEVSEKAKTLLIDRDLTEFSELEYSEM
GSSFSVSPKAESAVIVANPREEIIVKNKDEEEKLVSNNILHNQQELPTALTKLVKEDEVV
SSEKAKDSFNEKRVAVEAPMREEYADFKPFERVWEVKDSKEDSDMLAAGGKIESNLESKV
DKKCFADSLEQTNHEKDSESSNDDTSFPSTPEGIKDRSGAYITCAPFNPAATESIATNIF
PLLGDPTSENKTDEKKIEEKKAQIVTEKNTSTKTSNPFLVAAQDSETDYVTTDNLTKVTE
EVVANMPEGLTPDLVQEACESELNEVTGTKIAYETKMDLVQTSEVMQESLYPAAQLCPSF
EESEATPSPVLPDIVMEAPLNSAVPSAGASVIQPSSSPLEASSVNYESIKHEPENPPPYE
EAMSVSLKKVSGIKEEIKEPENINAALQETEAPYISIACDLIKETKLSAEPAPDFSDYSE
MAKVEQPVPDHSELVEDSSPDSEPVDLFSDDSIPDVPQKQDETVMLVKESLTETSFESMI
EYENKEKLSALPPEGGKPYLESFKLSLDNTKDTLLPDEVSTLSKKEKIPLQMEELSTAVY
SNDDLFISKEAQIRETETFSDSSPIEIIDEFPTLISSKTDSFSKLAREYTDLEVSHKSEI
ANAPDGAGSLPCTELPHDLSLKNIQPKVEEKISFSDDFSKNGSATSKVLLLPPDVSALAT
QAEIESIVKPKVLVKEAEKKLPSDTEKEDRSPSAIFSAELSKTSVVDLLYWRDIKKTGVV
FGASLFLLLSLTVFSIVSVTAYIALALLSVTISFRIYKGVIQAIQKSDEGHPFRAYLESE
VAISEELVQKYSNSALGHVNCTIKELRRLFLVDDLVDSLKFAVLMWVFTYVGALFNGLTL
LILALISLFSVPVIYERHQAQIDHYLGLANKNVKDAMAKIQAKIPGLKRKAE
NT seq 3579 nt   +upstreamnt  +downstreamnt
atggaagacctggaccagtctcctctggtctcgtcctcggacagcccaccccggccgcag
cccgcgttcaagtaccagttcgtgagggagcccgaggacgaggaggaagaagaggaggag
gaagaggaggacgaggacgaagacctggaggagctggaggtgctggagaggaagcccgcc
gccgggctgtccgcggccccagtgcccaccgcccctgccgccggcgcgcccctgatggac
ttcggaaatgacttcgtgccgccggcgccccggggacccctgccggccgctccccccgtc
gccccggagcggcagccgtcttgggacccgagcccggtgtcgtcgaccgtgcccgcgcca
tccccgctgtctgctgccgcagtctcgccctccaagctccctgaggacgacgagcctccg
gcccggcctccccctcctcccccggccagcgtgagcccccaggcagagcccgtgtggacc
ccgccagccccggctcccgccgcgcccccctccaccccggccgcgcccaagcgcaggggc
tcctcgggctcagtggatgagaccctttttgctcttcctgctgcatctgagcctgtgata
cgctcctctgcagaaaatatggacttgaaggagcagccaggtaacactatttcggctggt
caagaggatttcccatctgtcctgcttgaaactgctgcttctcttccttctctgtctcct
ctctcagccgcttctttcaaagaacatgaataccttggtaatttgtcaacagtattaccc
actgaaggaacacttcaagaaaatgtcagtgaagcttctaaagaggtctcagagaaggca
aaaactctactcatagatagagatttaacagagttttcagaattagaatactcagaaatg
ggatcatcgttcagtgtctctccaaaagcagaatctgccgtaatagtagcaaatcctagg
gaagaaataatcgtgaaaaataaagatgaagaagagaagttagttagtaataacatcctt
cataatcaacaagagttacctacagctcttactaaattggttaaagaggatgaagttgtg
tcttcagaaaaagcaaaagacagttttaatgaaaagagagttgcagtggaagctcctatg
agggaggaatatgcagacttcaaaccatttgagcgagtatgggaagtgaaagatagtaag
gaagatagtgatatgttggctgctggaggtaaaatcgagagcaacttggaaagtaaagtg
gataaaaaatgttttgcagatagccttgagcaaactaatcacgaaaaagatagtgagagt
agtaatgatgatacttctttccccagtacgccagaaggtataaaggatcgttcaggagca
tatatcacatgtgctccctttaacccagcagcaactgagagcattgcaacaaacattttt
cctttgttaggagatcctacttcagaaaataagaccgatgaaaaaaaaatagaagaaaag
aaggcccaaatagtaacagagaagaatactagcaccaaaacatcaaacccttttcttgta
gcagcacaggattctgagacagattatgtcacaacagataatttaacaaaggtgactgag
gaagtcgtggcaaacatgcctgaaggcctgactccagatttagtacaggaagcatgtgaa
agtgaattgaatgaagttactggtacaaagattgcttatgaaacaaaaatggacttggtt
caaacatcagaagttatgcaagagtcactctatcctgcagcacagctttgcccatcattt
gaagagtcagaagctactccttcaccagttttgcctgacattgttatggaagcaccattg
aattctgcagttcctagtgctggtgcttccgtgatacagcccagctcatcaccattagaa
gcttcttcagttaattatgaaagcataaaacatgagcctgaaaaccccccaccatatgaa
gaggccatgagtgtatcactaaaaaaagtatcaggaataaaggaagaaattaaagagcct
gaaaatattaatgcagctcttcaagaaacagaagctccttatatatctattgcatgtgat
ttaattaaagaaacaaagctttctgctgaaccagctccggatttctctgattattcagaa
atggcaaaagttgaacagccagtgcctgatcattctgagctagttgaagattcctcacct
gattctgaaccagttgacttatttagtgatgattcaatacctgacgttccacaaaaacaa
gatgaaactgtgatgcttgtgaaagaaagtctcactgagacttcatttgagtcaatgata
gaatatgaaaataaggaaaaactcagtgctttgccacctgagggaggaaagccatatttg
gaatcttttaagctcagtttagataacacaaaagataccctgttacctgatgaagtttca
acattgagcaaaaaggagaaaattcctttgcagatggaggagctcagtactgcagtttat
tcaaatgatgacttatttatttctaaggaagcacagataagagaaactgaaacgttttca
gattcatctccaattgaaattatagatgagttccctacattgatcagttctaaaactgat
tcattttctaaattagccagggaatatactgacctagaagtatcccacaaaagtgaaatt
gctaatgccccggatggagctgggtcattgccttgcacagaattgccccatgacctttct
ttgaagaacatacaacccaaagttgaagagaaaatcagtttctcagatgacttttctaaa
aatgggtctgctacatcaaaggtgctcttattgcctccagatgtttctgctttggccact
caagcagagatagagagcatagttaaacccaaagttcttgtgaaagaagctgagaaaaaa
cttccttccgatacagaaaaagaggacagatcaccatctgctatattttcagcagagctg
agtaaaacttcagttgttgacctcctgtactggagagacattaagaagactggagtggtg
tttggtgccagcctattcctgctgctttcattgacagtattcagcattgtgagcgtaaca
gcctacattgccttggccctgctctctgtgaccatcagctttaggatatacaagggtgtg
atccaagctatccagaaatcagatgaaggccacccattcagggcatatctggaatctgaa
gttgctatatctgaggagttggttcagaagtacagtaattctgctcttggtcatgtgaac
tgcacgataaaggaactcaggcgcctcttcttagttgatgatttagttgattctctgaag
tttgcagtgttgatgtgggtatttacctatgttggtgccttgtttaatggtctgacacta
ctgattttggctctcatttcactcttcagtgttcctgttatttatgaacggcatcaggca
cagatagatcattatctaggacttgcaaataagaatgttaaagatgctatggctaaaatc
caagcaaaaatccctggattgaagcgcaaagctgaatga

DBGET integrated database retrieval system