KEGG   Homo sapiens (human): 57152Help
Entry
57152             CDS       T01001                                 

Gene name
SLURP1, ANUP, ARS, ArsB, LY6-MT, LY6LS, MDM
Definition
(RefSeq) secreted LY6/PLAUR domain containing 1
  KO
K23681  secreted Ly-6/uPAR-related protein 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
Disease
H00695  Mal de Meleda
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    57152 (SLURP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UPAR_LY6 Toxin_TOLIP
Motif
Other DBs
NCBI-GeneID: 57152
NCBI-ProteinID: NP_065160
OMIM: 606119
HGNC: 18746
Ensembl: ENSG00000126233
Vega: OTTHUMG00000164685
Pharos: P55000(Tbio)
UniProt: P55000
Structure
PDB: 

Position
8q24.3
AA seq 103 aa AA seqDB search
MASRWAVQLLLVAAWSMGCGEALKCYTCKEPMTSASCRTITRCKPEDTACMTTLVTVEAE
YPFNQSPVVTRSCSSSCVATDPDSIGAAHLIFCCFRDLCNSEL
NT seq 312 nt NT seq  +upstreamnt  +downstreamnt
atggcctctcgctgggctgtgcagctgctgctcgtggcagcctggagcatgggctgtggt
gaggccctcaagtgctacacctgcaaggagcccatgaccagtgcttcctgcaggaccatt
acccgctgcaagccagaggacacagcctgcatgaccacgctggtgacggtggaggcagag
taccccttcaaccagagccccgtggtgacccgctcctgctccagctcctgtgtggccacc
gaccccgacagcatcggggccgcccacctgatcttctgctgcttccgagacctctgcaac
tcggaactctga

DBGET integrated database retrieval system