KEGG   Homo sapiens (human): 57153Help
Entry
57153             CDS       T01001                                 

Gene name
SLC44A2, CTL2, PP1292
Definition
(RefSeq) solute carrier family 44 member 2
  KO
K15377  solute carrier family 44 (choline transporter-like protein), member 2/4/5
Organism
hsa  Homo sapiens (human)
Pathway
hsa05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    57153 (SLC44A2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    57153 (SLC44A2)
   04147 Exosome [BR:hsa04147]
    57153 (SLC44A2)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC44: Choline-like transporter
   57153 (SLC44A2)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   57153 (SLC44A2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Choline_transpo
Motif
Other DBs
NCBI-GeneID: 57153
NCBI-ProteinID: NP_065161
OMIM: 606106
HGNC: 17292
Ensembl: ENSG00000129353
Vega: OTTHUMG00000180585
Pharos: Q8IWA5(Tbio)
UniProt: Q8IWA5
Position
19p13.2
AA seq 706 aa AA seqDB search
MGDERPHYYGKHGTPQKYDPTFKGPIYNRGCTDIICCVFLLLAIVGYVAVGIIAWTHGDP
RKVIYPTDSRGEFCGQKGTKNENKPYLFYFNIVKCASPLVLLEFQCPTPQICVEKCPDRY
LTYLNARSSRDFEYYKQFCVPGFKNNKGVAEVLQDGDCPAVLIPSKPLARRCFPAIHAYK
GVLMVGNETTYEDGHGSRKNITDLVEGAKKANGVLEARQLAMRIFEDYTVSWYWIIIGLV
IAMAMSLLFIILLRFLAGIMVWVMIIMVILVLGYGIFHCYMEYSRLRGEAGSDVSLVDLG
FQTDFRVYLHLRQTWLAFMIILSILEVIIILLLIFLRKRILIAIALIKEASRAVGYVMCS
LLYPLVTFFLLCLCIAYWASTAVFLSTSNEAVYKIFDDSPCPFTAKTCNPETFPSSNESR
QCPNARCQFAFYGGESGYHRALLGLQIFNAFMFFWLANFVLALGQVTLAGAFASYYWALR
KPDDLPAFPLFSAFGRALRYHTGSLAFGALILAIVQIIRVILEYLDQRLKAAENKFAKCL
MTCLKCCFWCLEKFIKFLNRNAYIMIAIYGTNFCTSARNAFFLLMRNIIRVAVLDKVTDF
LFLLGKLLIVGSVGILAFFFFTHRIRIVQDTAPPLNYYWVPILTVIVGSYLIAHGFFSVY
GMCVDTLFLCFLEDLERNDGSAERPYFMSSTLKKLLNKTNKKAAES
NT seq 2121 nt NT seq  +upstreamnt  +downstreamnt
atgggggacgagcggccccactactacgggaaacacggaacgccacagaagtatgatccc
actttcaaaggacccatttacaataggggctgcacggatatcatatgctgtgtgttcctg
ctcctggccattgtgggctacgtggctgtaggcatcatagcctggactcatggagaccct
cgaaaggtgatctaccccactgacagccggggcgagttctgcgggcagaagggcacaaaa
aacgagaacaaaccctatctgttttatttcaacattgtgaaatgtgccagccccctggtt
ctgctggaattccaatgtcccactccccagatctgcgtggaaaaatgccccgaccgctac
ctcacgtacctgaatgctcgcagctcccgggactttgagtactataagcagttctgtgtt
cctggcttcaagaacaataaaggagtggctgaggtgcttcaagatggtgactgccctgct
gtcctcatccccagcaaacccttggcccggagatgcttccccgctatccacgcctacaag
ggtgtcctgatggtgggcaatgagacgacctatgaggatgggcatggctcccggaaaaac
atcacagacctggtggagggcgccaagaaagccaatggagtcctagaggcgcggcaactc
gccatgcgcatatttgaagattacaccgtctcttggtactggattatcataggcctggtc
attgccatggcgatgagcctcctgttcatcatcctgcttcgcttcctggctggtattatg
gtctgggtgatgatcatcatggtgattctggtgctgggctacggaatatttcactgctac
atggagtactcccgactgcgtggtgaggccggctctgatgtctctttggtggacctcggc
tttcagacggatttccgggtgtacctgcacttacggcagacctggttggcctttatgatc
attctgagtatccttgaagtcattatcatcttgctgctcatctttctccggaagagaatt
ctcatcgcgattgcactcatcaaagaagccagcagggctgtgggatacgtcatgtgctcc
ttgctctacccactggtcaccttcttcttgctgtgcctctgcatcgcctactgggccagc
actgctgtcttcctgtccacttccaacgaagcggtctataagatctttgatgacagcccc
tgcccatttactgcgaaaacctgcaacccagagaccttcccctcctccaatgagtcccgc
caatgccccaatgcccgttgccagttcgccttctacggtggtgagtcgggctaccaccgg
gccctgctgggcctgcagatcttcaatgccttcatgttcttctggttggccaacttcgtg
ctggcgctgggccaggtcacgctggccggggcctttgcctcctactactgggccctgcgc
aagccggacgacctgccggccttcccgctcttctctgcctttggccgggcgctcaggtac
cacacaggctccctggcctttggcgcgctcatcctggccattgtgcagatcatccgtgtg
atactcgagtacctggatcagcggctgaaagctgcagagaacaagtttgccaagtgcctc
atgacctgtctcaaatgctgcttctggtgcctggagaagttcatcaaattccttaatagg
aatgcctacatcatgattgccatctacggcaccaatttctgcacctcggccaggaatgcc
ttcttcctgctcatgagaaacatcatcagagtggctgtcctggataaagttactgacttc
ctcttcctgttgggcaaacttctgatcgttggtagtgtggggatcctggctttcttcttc
ttcacccaccgtatcaggatcgtgcaggatacagcaccacccctcaattattactgggtt
cctatactgacggtgatcgttggctcctacttgattgcacacggtttcttcagcgtctat
ggcatgtgtgtggacacgctgttcctctgcttcttggaggacctggagaggaatgacggc
tcggccgagaggccttacttcatgtcttccaccctcaagaaactcttgaacaagaccaac
aagaaggcagcggagtcctga

DBGET integrated database retrieval system