KEGG   Homo sapiens (human): 57161Help
Entry
57161             CDS       T01001                                 

Gene name
PELI2
Definition
(RefSeq) pellino E3 ubiquitin protein ligase family member 2
  KO
K11964  pellino [EC:2.3.2.27]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    57161 (PELI2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     57161 (PELI2)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Pellino proteins
    57161 (PELI2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pellino zf-C3HC4_3 zf-RING_2
Motif
Other DBs
NCBI-GeneID: 57161
NCBI-ProteinID: NP_067078
OMIM: 614798
HGNC: 8828
Ensembl: ENSG00000139946
Vega: OTTHUMG00000152336
Pharos: Q9HAT8(Tbio)
UniProt: Q9HAT8 Q9H716
Structure
PDB: 

Position
14q22.3
AA seq 420 aa AA seqDB search
MFSPGQEEHCAPNKEPVKYGELVVLGYNGALPNGDRGRRKSRFALYKRPKANGVKPSTVH
VISTPQASKAISCKGQHSISYTLSRNQTVVVEYTHDKDTDMFQVGRSTESPIDFVVTDTI
SGSQNTDEAQITQSTISRFACRIVCDRNEPYTARIFAAGFDSSKNIFLGEKAAKWKNPDG
HMDGLTTNGVLVMHPRGGFTEESQPGVWREISVCGDVYTLRETRSAQQRGKLVESETNVL
QDGSLIDLCGATLLWRTADGLFHTPTQKHIEALRQEINAARPQCPVGLNTLAFPSINRKE
VVEEKQPWAYLSCGHVHGYHNWGHRSDTEANERECPMCRTVGPYVPLWLGCEAGFYVDAG
PPTHAFTPCGHVCSEKSAKYWSQIPLPHGTHAFHAACPFCATQLVGEQNCIKLIFQGPID
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgttttcccctggccaggaggaacactgcgcccccaataaggagccagtgaaatacggg
gagctggtggtgctcgggtacaatggtgctttacccaatggagatagaggacggaggaaa
agtagatttgccctctacaagcggcccaaggcaaatggtgtcaaacccagcaccgtccat
gtgatatccacgccccaggcatccaaggctatcagctgcaaaggtcaacacagtatatcc
tacactttgtcaaggaatcagactgtggtggtggagtacacacatgataaggatacggat
atgtttcaggtgggcagatcaacagaaagccctatcgacttcgttgtcacagacacgatt
tctggcagccagaacacggacgaagcccagatcacacagagcaccatatccaggttcgcc
tgcaggatcgtgtgcgacaggaatgaaccttacacagcacggatattcgccgccggattt
gactcttccaaaaacatatttcttggagaaaaggcagcaaagtggaaaaaccccgacggc
cacatggatgggctcactactaatggcgtcctggtgatgcatccacgagggggcttcacc
gaggagtcccagcccggggtctggcgcgagatctctgtctgtggagatgtgtacaccttg
cgagaaaccaggtcggcccagcaacgaggaaagctggtggaaagtgagaccaacgtcctg
caggacggctccctcattgacctgtgtggggccactctcctctggagaacagcagatggg
ctttttcatactccaactcagaagcacatagaagccctccggcaggagattaacgccgcc
cggcctcagtgtcctgtggggctcaacaccctggccttccccagcatcaacaggaaagag
gtggtggaggagaagcagccctgggcatatctcagttgtggccacgtgcacgggtaccac
aactggggccatcggagtgacacggaggccaacgagagggagtgtcccatgtgcaggact
gtgggcccctatgtgcctctctggcttggctgtgaggcaggattttatgtagacgcagga
ccgccaactcatgctttcactccctgtggacacgtgtgctcggagaagtctgcaaaatac
tggtctcagatcccgttgcctcatggaactcatgcatttcacgctgcttgccctttctgt
gctacacagctggttggggagcaaaactgcatcaaattaattttccaaggtccaattgac
tga

DBGET integrated database retrieval system