KEGG   Homo sapiens (human): 57162Help
Entry
57162             CDS       T01001                                 

Gene name
PELI1
Definition
(RefSeq) pellino E3 ubiquitin protein ligase 1
  KO
K11964  pellino [EC:2.3.2.27]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    57162 (PELI1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     57162 (PELI1)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Pellino proteins
    57162 (PELI1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pellino zf-RING_5 zf-RING_2
Motif
Other DBs
NCBI-GeneID: 57162
NCBI-ProteinID: NP_065702
OMIM: 614797
HGNC: 8827
Ensembl: ENSG00000197329
Vega: OTTHUMG00000129511
Pharos: Q96FA3(Tbio)
UniProt: Q96FA3 Q53T26
Position
2p14
AA seq 418 aa AA seqDB search
MFSPDQENHPSKAPVKYGELIVLGYNGSLPNGDRGRRKSRFALFKRPKANGVKPSTVHIA
CTPQAAKAISNKDQHSISYTLSRAQTVVVEYTHDSNTDMFQIGRSTESPIDFVVTDTVPG
SQSNSDTQSVQSTISRFACRIICERNPPFTARIYAAGFDSSKNIFLGEKAAKWKTSDGQM
DGLTTNGVLVMHPRNGFTEDSKPGIWREISVCGNVFSLRETRSAQQRGKMVEIETNQLQD
GSLIDLCGATLLWRTAEGLSHTPTVKHLEALRQEINAARPQCPVGFNTLAFPSMKRKDVV
DEKQPWVYLNCGHVHGYHNWGNKEERDGKDRECPMCRSVGPYVPLWLGCEAGFYVDAGPP
THAFSPCGHVCSEKTTAYWSQIPLPHGTHTFHAACPFCAHQLAGEQGYIRLIFQGPLD
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgttttctcctgatcaagaaaatcatccatctaaagcaccagtaaaatatggtgaactc
attgtcttagggtataatgggtctctcccaaatggcgatagaggaaggaggaaaagtagg
tttgctttgtttaaaagacctaaggcaaatggggtgaagcccagcactgtgcatattgct
tgtactcctcaggctgcaaaggcaataagcaacaaagaccagcatagcatatcatatact
ttatctcgggcccagactgtggtggttgaatatactcatgacagcaacaccgatatgttt
cagattggccggtcgactgaaagccccattgattttgtagtaactgacacggttcctgga
agtcaaagtaattctgatacacagtcagtacaaagcactatatcaagatttgcctgcaga
atcatatgtgaacggaatcctccctttacagcacggatttatgctgcaggatttgactca
tcaaaaaacatctttcttggggagaaggctgccaaatggaagacatcagatggacagatg
gatggcttgaccactaatggtgttcttgtgatgcatccacgcaatgggttcacagaagac
tccaagcctggaatatggagagaaatatcggtgtgtggaaatgtatttagcctacgtgaa
accagatcggctcagcagagaggaaaaatggtggaaattgaaaccaatcagttacaagat
ggctcgttaattgacctctgtggtgcaacattgttatggcgtactgcagaaggcctttcc
cacactcctaccgtgaagcatttagaagctttaagacaggaaatcaatgcagcacgacct
cagtgccctgtagggttcaacacactagcatttcctagtatgaagaggaaagacgttgta
gatgaaaaacaaccatgggtatatctaaactgcggccatgtacatggctatcataactgg
ggaaacaaagaagaacgtgatggaaaagatcgtgaatgtcctatgtgtaggtctgttggt
ccctatgttcctctgtggcttggatgtgaagctggattttatgtggacgccggccctcca
acccatgcgtttagcccgtgtgggcatgtgtgttcagaaaagacaactgcctattggtcc
cagatcccacttcctcatggtactcatacttttcatgcagcctgtcccttttgtgcacat
cagttggctggtgaacaaggctacatcagacttatttttcaaggacctctagactaa

DBGET integrated database retrieval system