KEGG   Homo sapiens (human): 57168Help
Entry
57168             CDS       T01001                                 

Gene name
ASPHD2
Definition
(RefSeq) aspartate beta-hydroxylase domain containing 2
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: Asp_Arg_Hydrox
Motif
Other DBs
NCBI-GeneID: 57168
NCBI-ProteinID: NP_065170
HGNC: 30437
Ensembl: ENSG00000128203
Vega: OTTHUMG00000150884
Pharos: Q6ICH7(Tdark)
UniProt: Q6ICH7 A0A024R1D0
Position
22q12.1
AA seq 369 aa AA seqDB search
MVWAPLGPPRTDCLTLLHTPSKDSPKMSLEWLVAWSWSLDGLRDCIATGIQSVRDCDTTA
VITVACLLVLFVWYCYHVGREQPRPYVSVNSLMQAADANGLQNGYVYCQSPECVRCTHNE
GLNQKLYHNLQEYAKRYSWSGMGRIHKGIREQGRYLNSRPSIQKPEVFFLPDLPTTPYFS
RDAQKHDVEVLERNFQTILCEFETLYKAFSNCSLPQGWKMNSTPSGEWFTFYLVNQGVCV
PRNCRKCPRTYRLLGSLRTCIGNNVFGNACISVLSPGTVITEHYGPTNIRIRCHLGLKTP
NGCELVVGGEPQCWAEGRCLLFDDSFLHAAFHEGSAEDGPRVVFMVDLWHPNVAAAERQA
LDFIFAPGR
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atggtgtgggcgcccttgggacccccgaggactgattgtctgaccttgcttcacacgccc
agtaaggactcccccaagatgtcgctcgagtggctggtggcctggagctggtcgctggat
ggcctgagggactgcatcgccaccggcatccagtccgtgcgggactgcgacaccaccgct
gtcatcactgtggcctgcctcctggtcctcttcgtgtggtactgttatcacgtgggcagg
gagcagccccggccctacgtctccgtcaactccctcatgcaggctgccgatgccaacggg
ctgcagaatggctacgtgtactgccagtcccctgagtgcgtgcgctgcacccacaacgag
ggcctcaaccagaagctgtaccacaacctgcaggagtacgccaagcgctactcctggtcc
ggcatgggccgcatccacaagggcatccgcgagcagggccggtacctcaacagccggccc
tccatccagaagcccgaggtcttcttcctgcccgacctgcccaccacgccctatttctcc
cgggacgcacagaaacatgatgtggaagtgctggaacggaacttccagaccatcctgtgt
gagtttgagaccctctacaaagctttctcaaactgcagcctcccgcaaggatggaaaatg
aacagcacccccagcggggagtggttcaccttttacttggtcaatcagggggtttgtgtt
cccaggaactgtaggaagtgcccacggacgtaccgcttgctcggaagccttcggacctgt
attgggaacaatgtttttgggaacgcgtgcatctctgtgctgagccctgggactgtgata
acggagcactatggacccaccaacatccgcatccgatgccatttaggtctgaaaactcca
aatggctgtgagctggtggtggggggagagccccagtgctgggcagaagggcgctgcctt
ctctttgatgactctttcctgcatgctgcgttccatgaaggttcagcagaggatggccca
cgggtggttttcatggtggatttgtggcatccaaacgtcgcagcggccgaacggcaggct
cttgatttcatctttgctccgggacgatga

DBGET integrated database retrieval system