KEGG   Homo sapiens (human): 5717Help
Entry
5717              CDS       T01001                                 

Gene name
PSMD11, Rpn6, S9, p44.5
Definition
(RefSeq) proteasome 26S subunit, non-ATPase 11
  KO
K03036  26S proteasome regulatory subunit N6
Organism
hsa  Homo sapiens (human)
Pathway
hsa03050  Proteasome
hsa05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    5717 (PSMD11)
 09160 Human Diseases
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    5717 (PSMD11)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:hsa03051]
    5717 (PSMD11)
Proteasome [BR:hsa03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    non-ATPase subunits
     5717 (PSMD11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RPN6_N PCI RPN6_C_helix TPR_12 DDRGK DUF2153 SbsC_C AAA_16
Motif
Other DBs
NCBI-GeneID: 5717
NCBI-ProteinID: NP_001257411
OMIM: 604449
HGNC: 9556
Ensembl: ENSG00000108671
Vega: OTTHUMG00000132811
Pharos: O00231(Tbio)
UniProt: O00231
Structure
PDB: 

Position
17q11.2
AA seq 422 aa AA seqDB search
MAAAAVVEFQRAQSLLSTDREASIDILHSIVKRDIQENDEEAVQVKEQSILELGSLLAKT
GQAAELGGLLKYVRPFLNSISKAKAARLVRSLLDLFLDMEAATGQEVELCLECIEWAKSE
KRTFLRQALEARLVSLYFDTKRYQEALHLGSQLLRELKKMDDKALLVEVQLLESKTYHAL
SNLPKARAALTSARTTANAIYCPPKLQATLDMQSGIIHAAEEKDWKTAYSYFYEAFEGYD
SIDSPKAITSLKYMLLCKIMLNTPEDVQALVSGKLALRYAGRQTEALKCVAQASKNRSLA
DFEKALTDYRAELRDDPIISTHLAKLYDNLLEQNLIRVIEPFSRVQIEHISSLIKLSKAD
VERKLSQMILDKKFHGILDQGEGVLIIFDEPPVDKTYEAALETIQNMSKVVDSLYNKAKK
LT
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggcggcggtggtggagttccagagagcccagtctctactcagcaccgaccgg
gaggcctccatcgacatcctccactccatcgtgaagcgtgacattcaggaaaacgatgaa
gaggcagtgcaagtcaaagagcagagcatcctggaactgggatctctcctggcaaagact
ggacaagctgcagagcttggaggactcctgaagtatgtacgacccttcttgaattccatc
agcaaggctaaagcagctcgcctggtccgatctcttcttgatctgtttcttgatatggaa
gcagctacagggcaggaggtcgagctgtgtttagagtgcatcgaatgggccaagtcagag
aaaagaactttcttacgccaagctttggaggcaagactggtgtctttgtactttgatacc
aagaggtaccaggaagcattgcatttgggttctcagctgctgcgggagttgaaaaagatg
gacgacaaagctcttttggtggaagtacagcttttagaaagcaaaacataccatgccctg
agcaacctgccgaaagcccgagctgccttaacttctgctcgaaccacagcaaatgccatc
tactgcccccctaaattgcaggccaccttggacatgcagtcgggtattatccatgcagca
gaagagaaggactggaaaactgcgtactcatacttctatgaggcatttgagggttatgac
tccatcgacagccccaaggccatcacatctctgaagtacatgttgctgtgcaaaatcatg
ctcaacaccccagaagatgtccaggctttggtgagcgggaagcttgcacttcggtatgca
gggaggcagacagaagcattaaaatgcgtggctcaggctagcaagaacagatcactggca
gattttgaaaaggctctgacagattaccgggcagagctccgggatgacccaatcatcagc
acacacttggccaagttgtatgataacttactagaacagaatctgatccgagtcattgag
cctttttccagagtacagattgaacacatatctagtctcatcaaactctccaaggccgac
gtggaaaggaaattatcacagatgattcttgacaagaaatttcatgggattttggaccag
ggggagggtgtcctgattattttcgatgaacccccagtagataaaacttacgaagctgct
ctggaaacaattcagaacatgagcaaagtagtggattccctctacaacaaagccaagaaa
ctgacatag

DBGET integrated database retrieval system