KEGG   Homo sapiens (human): 5717
Entry
5717              CDS       T01001                                 

Gene name
PSMD11, Rpn6, S9, p44.5
Definition
(RefSeq) proteasome 26S subunit, non-ATPase 11
  KO
K03036  26S proteasome regulatory subunit N6
Organism
hsa  Homo sapiens (human)
Pathway
hsa03050  Proteasome
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05016  Huntington disease
hsa05017  Spinocerebellar ataxia
hsa05169  Epstein-Barr virus infection
Network
nt06420  Ubiquitin-proteasome system
nt06460  Alzheimer disease
nt06461  Huntington disease
nt06463  Parkinson disease
  Element
N01029  26S proteasome-mediated protein degradation
N01030  Mutation-caused aberrant SNCA to 26S proteasome-mediated protein degradation
N01060  Mutation-caused aberrant Abeta to 26S proteasome-mediated protein degradation
N01061  Mutation-caused aberrant Htt to 26S proteasome-mediated protein degradation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    5717 (PSMD11)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    5717 (PSMD11)
   05012 Parkinson disease
    5717 (PSMD11)
   05016 Huntington disease
    5717 (PSMD11)
   05017 Spinocerebellar ataxia
    5717 (PSMD11)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    5717 (PSMD11)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:hsa03051]
    5717 (PSMD11)
Proteasome [BR:hsa03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    non-ATPase subunits
     5717 (PSMD11)
SSDB
Motif
Pfam: RPN6_N PCI RPN6_C_helix TPR_12 DDRGK DUF2153 AAA_16
Other DBs
NCBI-GeneID: 5717
NCBI-ProteinID: NP_001257411
OMIM: 604449
HGNC: 9556
Ensembl: ENSG00000108671
Vega: OTTHUMG00000132811
Pharos: O00231(Tbio)
UniProt: O00231
Structure
PDB: 

Position
17q11.2
AA seq 422 aa
MAAAAVVEFQRAQSLLSTDREASIDILHSIVKRDIQENDEEAVQVKEQSILELGSLLAKT
GQAAELGGLLKYVRPFLNSISKAKAARLVRSLLDLFLDMEAATGQEVELCLECIEWAKSE
KRTFLRQALEARLVSLYFDTKRYQEALHLGSQLLRELKKMDDKALLVEVQLLESKTYHAL
SNLPKARAALTSARTTANAIYCPPKLQATLDMQSGIIHAAEEKDWKTAYSYFYEAFEGYD
SIDSPKAITSLKYMLLCKIMLNTPEDVQALVSGKLALRYAGRQTEALKCVAQASKNRSLA
DFEKALTDYRAELRDDPIISTHLAKLYDNLLEQNLIRVIEPFSRVQIEHISSLIKLSKAD
VERKLSQMILDKKFHGILDQGEGVLIIFDEPPVDKTYEAALETIQNMSKVVDSLYNKAKK
LT
NT seq 1269 nt   +upstreamnt  +downstreamnt
atggcggcggcggcggtggtggagttccagagagcccagtctctactcagcaccgaccgg
gaggcctccatcgacatcctccactccatcgtgaagcgtgacattcaggaaaacgatgaa
gaggcagtgcaagtcaaagagcagagcatcctggaactgggatctctcctggcaaagact
ggacaagctgcagagcttggaggactcctgaagtatgtacgacccttcttgaattccatc
agcaaggctaaagcagctcgcctggtccgatctcttcttgatctgtttcttgatatggaa
gcagctacagggcaggaggtcgagctgtgtttagagtgcatcgaatgggccaagtcagag
aaaagaactttcttacgccaagctttggaggcaagactggtgtctttgtactttgatacc
aagaggtaccaggaagcattgcatttgggttctcagctgctgcgggagttgaaaaagatg
gacgacaaagctcttttggtggaagtacagcttttagaaagcaaaacataccatgccctg
agcaacctgccgaaagcccgagctgccttaacttctgctcgaaccacagcaaatgccatc
tactgcccccctaaattgcaggccaccttggacatgcagtcgggtattatccatgcagca
gaagagaaggactggaaaactgcgtactcatacttctatgaggcatttgagggttatgac
tccatcgacagccccaaggccatcacatctctgaagtacatgttgctgtgcaaaatcatg
ctcaacaccccagaagatgtccaggctttggtgagcgggaagcttgcacttcggtatgca
gggaggcagacagaagcattaaaatgcgtggctcaggctagcaagaacagatcactggca
gattttgaaaaggctctgacagattaccgggcagagctccgggatgacccaatcatcagc
acacacttggccaagttgtatgataacttactagaacagaatctgatccgagtcattgag
cctttttccagagtacagattgaacacatatctagtctcatcaaactctccaaggccgac
gtggaaaggaaattatcacagatgattcttgacaagaaatttcatgggattttggaccag
ggggagggtgtcctgattattttcgatgaacccccagtagataaaacttacgaagctgct
ctggaaacaattcagaacatgagcaaagtagtggattccctctacaacaaagccaagaaa
ctgacatag

DBGET integrated database retrieval system