KEGG   Homo sapiens (human): 5718
Entry
5718              CDS       T01001                                 

Gene name
PSMD12, Rpn5, STISS, p55
Definition
(RefSeq) proteasome 26S subunit, non-ATPase 12
  KO
K03035  26S proteasome regulatory subunit N5
Organism
hsa  Homo sapiens (human)
Pathway
hsa03050  Proteasome
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05016  Huntington disease
hsa05017  Spinocerebellar ataxia
hsa05169  Epstein-Barr virus infection
Network
nt06420  Ubiquitin-proteasome system
nt06460  Alzheimer disease
nt06461  Huntington disease
nt06463  Parkinson disease
  Element
N01029  26S proteasome-mediated protein degradation
N01030  Mutation-caused aberrant SNCA to 26S proteasome-mediated protein degradation
N01060  Mutation-caused aberrant Abeta to 26S proteasome-mediated protein degradation
N01061  Mutation-caused aberrant Htt to 26S proteasome-mediated protein degradation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    5718 (PSMD12)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    5718 (PSMD12)
   05012 Parkinson disease
    5718 (PSMD12)
   05016 Huntington disease
    5718 (PSMD12)
   05017 Spinocerebellar ataxia
    5718 (PSMD12)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    5718 (PSMD12)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:hsa03051]
    5718 (PSMD12)
Proteasome [BR:hsa03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    non-ATPase subunits
     5718 (PSMD12)
SSDB
Motif
Pfam: PCI RPN5_C
Other DBs
NCBI-GeneID: 5718
NCBI-ProteinID: NP_002807
OMIM: 604450
HGNC: 9557
Ensembl: ENSG00000197170
Vega: OTTHUMG00000140376
Pharos: O00232(Tbio)
UniProt: O00232 A0A0S2Z489
Structure
PDB: 

Position
17q24.2
AA seq 456 aa
MADGGSERADGRIVKMEVDYSATVDQRLPECAKLAKEGRLQEVIETLLSLEKQTRTASDM
VSTSRILVAVVKMCYEAKEWDLLNENIMLLSKRRSQLKQAVAKMVQQCCTYVEEITDLPI
KLRLIDTLRMVTEGKIYVEIERARLTKTLATIKEQNGDVKEAASILQELQVETYGSMEKK
ERVEFILEQMRLCLAVKDYIRTQIISKKINTKFFQEENTEKLKLKYYNLMIQLDQHEGSY
LSICKHYRAIYDTPCIQAESEKWQQALKSVVLYVILAPFDNEQSDLVHRISGDKKLEEIP
KYKDLLKLFTTMELMRWSTLVEDYGMELRKGSLESPATDVFGSTEEGEKRWKDLKNRVVE
HNIRIMAKYYTRITMKRMAQLLDLSVDESEAFLSNLVVNKTIFAKVDRLAGIINFQRPKD
PNNLLNDWSQKLNSLMSLVNKTTHLIAKEEMIHNLQ
NT seq 1371 nt   +upstreamnt  +downstreamnt
atggcggacggcggctcggagcgggctgacgggcgcatcgtcaagatggaggtggactac
agcgccacggtggatcagcgcctacccgagtgtgcgaagctagccaaggaaggaagactt
caagaagtcattgaaacccttctctctctggaaaagcagactcgtactgcttccgatatg
gtatcgacatcccgtatcttagttgcagtagtgaagatgtgctatgaggctaaagaatgg
gatttacttaatgaaaatattatgcttttgtccaaaaggcggagtcagttaaaacaagct
gttgccaaaatggttcaacagtgctgtacttatgttgaggaaatcacagaccttcctatc
aaacttcgattaattgatactctacgaatggttaccgaaggcaagatttatgttgaaatt
gagcgtgcgcgactgactaaaacattagcaactataaaagaacaaaatggtgatgtgaaa
gaggcagcctccattttacaggagttacaggtggaaacctacgggtcaatggaaaagaaa
gagcgagtggaatttattttggagcaaatgaggctctgcctagctgtgaaggattacatt
cgaacacaaatcatcagcaagaaaattaacaccaaatttttccaggaagaaaatacagag
aaattaaagttgaagtactataatttaatgattcagctggatcaacatgagggatcctat
ttgtctatttgtaagcactacagagcaatatatgatactccctgtatacaggcagaaagt
gaaaaatggcagcaggctctgaagagtgttgtactctatgttatcctggctccttttgac
aatgaacagtcagatttggttcaccgaataagtggtgacaagaagttagaagaaattccc
aaatacaaggatcttttaaagctttttaccacaatggagttgatgcgttggtccacactt
gttgaggactatggaatggaattaagaaaaggttcccttgagagtcctgcaacggatgtt
tttggttctacagaggaaggtgaaaaaaggtggaaagacttgaagaacagagttgttgaa
cataatattagaataatggccaagtattatactcggataacaatgaaaaggatggcacag
cttctggatctatctgttgatgagtccgaagcctttctctcaaatctagtagttaacaag
accatctttgctaaagtagacagattagcaggaattatcaacttccagagacccaaggat
ccaaataatttattaaatgactggtctcagaaactgaactcattaatgtctctggttaac
aaaactacgcatctcatagccaaagaggagatgatacataatctacaataa

DBGET integrated database retrieval system