KEGG   Homo sapiens (human): 57180
Entry
57180             CDS       T01001                                 
Symbol
ACTR3B, ARP11, ARP3BETA
Name
(RefSeq) actin related protein 3B
  KO
K18584  actin-related protein 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
hsa04530  Tight junction
hsa04666  Fc gamma R-mediated phagocytosis
hsa04810  Regulation of actin cytoskeleton
hsa05100  Bacterial invasion of epithelial cells
hsa05130  Pathogenic Escherichia coli infection
hsa05131  Shigellosis
hsa05132  Salmonella infection
hsa05135  Yersinia infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    57180 (ACTR3B)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    57180 (ACTR3B)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    57180 (ACTR3B)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    57180 (ACTR3B)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    57180 (ACTR3B)
   05132 Salmonella infection
    57180 (ACTR3B)
   05131 Shigellosis
    57180 (ACTR3B)
   05135 Yersinia infection
    57180 (ACTR3B)
   05100 Bacterial invasion of epithelial cells
    57180 (ACTR3B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    57180 (ACTR3B)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    57180 (ACTR3B)
   04147 Exosome [BR:hsa04147]
    57180 (ACTR3B)
Membrane trafficking [BR:hsa04131]
 Others
  Actin-binding proteins
   Arp2/3 complex
    57180 (ACTR3B)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Arp2/3 complex
     57180 (ACTR3B)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   57180 (ACTR3B)
  Exosomal proteins of other body fluids (saliva and urine)
   57180 (ACTR3B)
  Exosomal proteins of bladder cancer cells
   57180 (ACTR3B)
SSDB
Motif
Pfam: Actin MreB_Mbl KilA-N ALP_N Robl_LC7
Other DBs
NCBI-GeneID: 57180
NCBI-ProteinID: NP_065178
HGNC: 17256
Ensembl: ENSG00000133627
Pharos: Q9P1U1(Tbio)
UniProt: Q9P1U1 Q59GD5
Position
7:152759752..152855378
AA seq 418 aa
MAGSLPPCVVDCGTGYTKLGYAGNTEPQFIIPSCIAIRESAKVVDQAQRRVLRGVDDLDF
FIGDEAIDKPTYATKWPIRHGIIEDWDLMERFMEQVVFKYLRAEPEDHYFLMTEPPLNTP
ENREYLAEIMFESFNVPGLYIAVQAVLALAASWTSRQVGERTLTGIVIDSGDGVTHVIPV
AEGYVIGSCIKHIPIAGRDITYFIQQLLREREVGIPPEQSLETAKAIKEKYCYICPDIVK
EFAKYDVDPRKWIKQYTGINAINQKKFVIDVGYERFLGPEIFFHPEFANPDFMESISDVV
DEVIQNCPIDVRRPLYKNVVLSGGSTMFRDFGRRLQRDLKRVVDARLRLSEELSGGRIKP
KPVEVQVVTHHMQRYAVWFGGSMLASTPEFFQVCHTKKDYEEYGPSICRHNPVFGVMS
NT seq 1257 nt   +upstreamnt  +downstreamnt
atggcaggctccctgcctccctgcgtggtggactgtggcaccgggtataccaagcttggc
tacgcaggcaacactgagccccagttcattattccttcatgtattgccatcagagagtca
gcaaaggtagttgaccaagctcaaaggagagtgttgaggggagttgatgaccttgacttt
ttcataggagatgaagccatcgataaacctacatatgctacaaagtggccgatacgacat
ggaatcattgaagactgggatcttatggaaaggttcatggagcaagtggtttttaaatat
cttcgagctgaacctgaggaccattattttttaatgacagaacctccactcaatacacca
gaaaacagagagtatcttgcagaaattatgtttgaatcatttaacgtaccaggactctac
attgcagttcaggcagtgctggccttggcggcatcttggacatctcgacaagtgggtgaa
cgtacgttaacggggatagtcattgacagcggagatggagtcacccatgttatcccagtg
gcagaaggttatgtaattggaagctgcatcaaacacatcccgattgcaggtagagatatt
acgtatttcattcaacagctgctaagggagagggaggtgggaatccctcctgagcagtca
ctggagaccgcaaaagccattaaggagaaatactgttacatttgccccgatatagtcaag
gaatttgccaagtatgatgtggatccccggaagtggatcaaacagtacacgggtatcaat
gcgatcaaccagaagaagtttgttatagacgttggttacgaaagattcctgggacctgaa
atattctttcacccggagtttgccaacccagactttatggagtccatctcagatgttgtt
gatgaagtaatacagaactgccccatcgatgtgcggcgcccgctgtataagaatgtcgta
ctctcaggaggctccaccatgttcagggatttcggacgccgactgcagagggatttgaag
agagtggtggatgctaggctgaggctcagcgaggagctcagcggcgggaggatcaagccg
aagcctgtggaggtccaggtggtcacgcatcacatgcagcgctacgccgtgtggttcgga
ggctccatgctggcctcgactcccgagttctttcaggtctgccacaccaagaaggactat
gaagagtacgggcccagcatctgccgccacaaccccgtctttggagtcatgtcctag

DBGET integrated database retrieval system