KEGG   Homo sapiens (human): 57180Help
Entry
57180             CDS       T01001                                 

Gene name
ACTR3B, ARP11, ARP3BETA
Definition
(RefSeq) ARP3 actin related protein 3 homolog B
  KO
K18584  actin-related protein 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04530  Tight junction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cellular community - eukaryotes
   04530 Tight junction
    57180 (ACTR3B)
Membrane trafficking [BR:hsa04131]
 Others
  Actin-binding proteins
   Arp2/3 complex
    57180 (ACTR3B)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Arp2/3 complex
     57180 (ACTR3B)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   57180 (ACTR3B)
  Exosomal proteins of other body fluids (saliva and urine)
   57180 (ACTR3B)
  Exosomal proteins of bladder cancer cells
   57180 (ACTR3B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Actin MreB_Mbl FtsA KilA-N Robl_LC7
Motif
Other DBs
NCBI-GeneID: 57180
NCBI-ProteinID: NP_065178
HGNC: 17256
Ensembl: ENSG00000133627
Vega: OTTHUMG00000151463
Pharos: Q9P1U1(Tbio)
UniProt: Q9P1U1 Q59GD5
Position
7q36.1-q36.2
AA seq 418 aa AA seqDB search
MAGSLPPCVVDCGTGYTKLGYAGNTEPQFIIPSCIAIRESAKVVDQAQRRVLRGVDDLDF
FIGDEAIDKPTYATKWPIRHGIIEDWDLMERFMEQVVFKYLRAEPEDHYFLMTEPPLNTP
ENREYLAEIMFESFNVPGLYIAVQAVLALAASWTSRQVGERTLTGIVIDSGDGVTHVIPV
AEGYVIGSCIKHIPIAGRDITYFIQQLLREREVGIPPEQSLETAKAIKEKYCYICPDIVK
EFAKYDVDPRKWIKQYTGINAINQKKFVIDVGYERFLGPEIFFHPEFANPDFMESISDVV
DEVIQNCPIDVRRPLYKNVVLSGGSTMFRDFGRRLQRDLKRVVDARLRLSEELSGGRIKP
KPVEVQVVTHHMQRYAVWFGGSMLASTPEFFQVCHTKKDYEEYGPSICRHNPVFGVMS
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atggcaggctccctgcctccctgcgtggtggactgtggcaccgggtataccaagcttggc
tacgcaggcaacactgagccccagttcattattccttcatgtattgccatcagagagtca
gcaaaggtagttgaccaagctcaaaggagagtgttgaggggagttgatgaccttgacttt
ttcataggagatgaagccatcgataaacctacatatgctacaaagtggccgatacgacat
ggaatcattgaagactgggatcttatggaaaggttcatggagcaagtggtttttaaatat
cttcgagctgaacctgaggaccattattttttaatgacagaacctccactcaatacacca
gaaaacagagagtatcttgcagaaattatgtttgaatcatttaacgtaccaggactctac
attgcagttcaggcagtgctggccttggcggcatcttggacatctcgacaagtgggtgaa
cgtacgttaacggggatagtcattgacagcggagatggagtcacccatgttatcccagtg
gcagaaggttatgtaattggaagctgcatcaaacacatcccgattgcaggtagagatatt
acgtatttcattcaacagctgctaagggagagggaggtgggaatccctcctgagcagtca
ctggagaccgcaaaagccattaaggagaaatactgttacatttgccccgatatagtcaag
gaatttgccaagtatgatgtggatccccggaagtggatcaaacagtacacgggtatcaat
gcgatcaaccagaagaagtttgttatagacgttggttacgaaagattcctgggacctgaa
atattctttcacccggagtttgccaacccagactttatggagtccatctcagatgttgtt
gatgaagtaatacagaactgccccatcgatgtgcggcgcccgctgtataagaatgtcgta
ctctcaggaggctccaccatgttcagggatttcggacgccgactgcagagggatttgaag
agagtggtggatgctaggctgaggctcagcgaggagctcagcggcgggaggatcaagccg
aagcctgtggaggtccaggtggtcacgcatcacatgcagcgctacgccgtgtggttcgga
ggctccatgctggcctcgactcccgagttctttcaggtctgccacaccaagaaggactat
gaagagtacgggcccagcatctgccgccacaaccccgtctttggagtcatgtcctag

DBGET integrated database retrieval system