KEGG   Homo sapiens (human): 57181Help
Entry
57181             CDS       T01001                                 

Gene name
SLC39A10, LZT-Hs2
Definition
(RefSeq) solute carrier family 39 member 10
  KO
K14716  solute carrier family 39 (zinc transporter), member 10
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    57181 (SLC39A10)
Transporters [BR:hsa02000]
 Solute Carrier Family (SLC)
  SLC39: Metal ion transporter
   57181 (SLC39A10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Zip DUF4018 Mntp
Motif
Other DBs
NCBI-GeneID: 57181
NCBI-ProteinID: NP_001120729
OMIM: 608733
HGNC: 20861
Ensembl: ENSG00000196950
Vega: OTTHUMG00000154380
Pharos: Q9ULF5(Tbio)
UniProt: Q9ULF5 A0A024R3W5 Q05C42
Position
2q32.3
AA seq 831 aa AA seqDB search
MKVHMHTKFCLICLLTFIFHHCNHCHEEHDHGPEALHRQHRGMTELEPSKFSKQAAENEK
KYYIEKLFERYGENGRLSFFGLEKLLTNLGLGERKVVEINHEDLGHDHVSHLDILAVQEG
KHFHSHNHQHSHNHLNSENQTVTSVSTKRNHKCDPEKETVEVSVKSDDKHMHDHNHRLRH
HHRLHHHLDHNNTHHFHNDSITPSERGEPSNEPSTETNKTQEQSDVKLPKGKRKKKGRKS
NENSEVITPGFPPNHDQGEQYEHNRVHKPDRVHNPGHSHVHLPERNGHDPGRGHQDLDPD
NEGELRHTRKREAPHVKNNAIISLRKDLNEDDHHHECLNVTQLLKYYGHGANSPISTDLF
TYLCPALLYQIDSRLCIEHFDKLLVEDINKDKNLVPEDEANIGASAWICGIISITVISLL
SLLGVILVPIINQGCFKFLLTFLVALAVGTMSGDALLHLLPHSQGGHDHSHQHAHGHGHS
HGHESNKFLEEYDAVLKGLVALGGIYLLFIIEHCIRMFKHYKQQRGKQKWFMKQNTEEST
IGRKLSDHKLNNTPDSDWLQLKPLAGTDDSVVSEDRLNETELTDLEGQQESPPKNYLCIE
EEKIIDHSHSDGLHTIHEHDLHAAAHNHHGENKTVLRKHNHQWHHKHSHHSHGPCHSGSD
LKETGIANIAWMVIMGDGIHNFSDGLAIGAAFSAGLTGGISTSIAVFCHELPHELGDFAV
LLKAGMTVKQAIVYNLLSAMMAYIGMLIGTAVGQYANNITLWIFAVTAGMFLYVALVDML
PEMLHGDGDNEEHGFCPVGQFILQNLGLLFGFAIMLVIALYEDKIVFDIQF
NT seq 2496 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtacatatgcacacaaaattttgcctcatttgtttgctgacatttatttttcat
cattgcaaccattgccatgaagaacatgaccatggccctgaagcgcttcacagacagcat
cgtggaatgacagaattggagccaagcaaattttcaaagcaagctgctgaaaatgaaaaa
aaatactatattgaaaaactttttgagcgttatggtgaaaatggaagattatcctttttt
ggtttggagaaacttttaacaaacttgggccttggagagagaaaagtagttgagattaat
catgaggatcttggccacgatcatgtttctcatttagatattttggcagttcaagaggga
aagcattttcactcacataaccaccagcattcccataatcatttaaattcagaaaatcaa
actgtgaccagtgtatccacaaaaagaaaccataaatgtgatccagagaaagagacagtt
gaagtgtctgtaaaatctgatgataaacatatgcatgaccataatcaccgcctacgtcat
caccatcgtttgcatcatcatcttgatcataacaacactcaccattttcataatgattcc
attactcccagtgagcgtggggagcctagcaatgaaccttcaacagagaccaataaaacc
caggaacaatctgatgttaaactaccgaaaggaaagaggaagaaaaaagggaggaaaagt
aatgaaaattctgaggttattacaccaggttttccccctaaccatgatcagggtgaacag
tatgagcataatcgggtccacaaacctgatcgtgtacataacccaggtcattctcatgta
catcttccagaacgtaatggtcatgatcctggtcgtggacaccaagatcttgatcctgat
aatgaaggtgaacttcgacatactagaaagagagaagcaccacatgttaaaaataatgca
ataatttctttgagaaaagatctaaatgaagatgaccatcatcatgaatgtttgaacgtc
actcagttattaaaatactatggtcatggtgccaactctcccatctcaactgatttattt
acatacctttgccctgcattgttatatcaaatcgacagcagactttgtattgagcatttt
gacaaacttttagttgaagatataaataaggataaaaacctggttcctgaagatgaggca
aatataggggcatcagcctggatttgtggtatcatttctatcactgtcattagcctgctt
tccttgctaggcgtgatcttggttcctatcattaaccaaggatgcttcaaattccttctt
acattccttgttgcattagctgtaggaacaatgagtggagacgcccttcttcatctactg
ccccattctcagggtggacatgatcacagtcaccaacatgcacatgggcatggacattct
catggacatgaatctaacaagtttttggaagaatatgatgctgtattgaaaggacttgtt
gctctaggaggcatttacttgctatttatcattgaacactgcattagaatgtttaagcac
tacaaacaacaaagaggaaaacagaaatggtttatgaaacagaacacagaagaatcaact
attggaagaaagctttcagatcacaagttaaacaatacaccagattctgactggcttcaa
ctcaagcctcttgccggaactgatgactcggttgtttctgaagatcgacttaatgaaact
gaactgacagatttagaaggccaacaagaatcccctcctaaaaattacctttgtatagaa
gaggagaaaatcatagaccattctcacagtgatggattacataccattcatgagcatgat
ctccatgctgctgcacataaccaccacggcgagaacaaaactgtgctgaggaagcataat
caccagtggcaccacaagcattctcatcattcccatggcccctgtcattctggatccgat
ctgaaagaaacaggaatagctaatatagcctggatggtgatcatgggggatggcatccac
aacttcagtgatgggctcgcaattggtgcagctttcagtgctggattgacaggaggaatc
agtacttctatagccgtcttctgtcatgaactgccacatgaattaggagattttgcagtt
cttcttaaagcaggcatgactgtaaagcaagcaattgtatacaacctcctctctgccatg
atggcttacataggcatgctcataggcacagctgttggtcagtatgccaataacatcaca
ctttggatctttgcagtcactgcaggcatgttcctctatgtagccttggtggatatgctt
ccagaaatgttgcatggtgatggtgacaatgaagaacatggcttttgtcctgtggggcaa
ttcatccttcagaatttaggattgctctttggatttgccattatgctggtgattgccctc
tatgaagataaaattgtgtttgacatccagttttga

DBGET integrated database retrieval system