KEGG   Homo sapiens (human): 57185Help
Entry
57185             CDS       T01001                                 

Gene name
NIPAL3, DJ462O23.2, NPAL3
Definition
(RefSeq) NIPA like domain containing 3
  KO
K22733  magnesium transporter
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    57185 (NIPAL3)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC57: NiPA-like magnesium transporter
   57185 (NIPAL3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Mg_trans_NIPA
Motif
Other DBs
NCBI-GeneID: 57185
NCBI-ProteinID: NP_001309783
HGNC: 25233
Ensembl: ENSG00000001461
Vega: OTTHUMG00000003299
Pharos: Q6P499(Tdark)
UniProt: Q6P499
Position
1p36.11
AA seq 406 aa AA seqDB search
MDGSHSAALKLQQLPPTSSSSAVSEASFSYKENLIGALLAIFGHLVVSIALNLQKYCHIR
LAGSKDPRAYFKTKTWWLGLFLMLLGELGVFASYAFAPLSLIVPLSAVSVIASAIIGIIF
IKEKWKPKDFLRRYVLSFVGCGLAVVGTYLLVTFAPNSHEKMTGENVTRHLVSWPFLLYM
LVEIILFCLLLYFYKEKNANNIVVILLLVALLGSMTVVTVKAVAGMLVLSIQGNLQLDYP
IFYVMFVCMVATAVYQAAFLSQASQMYDSSLIASVGYILSTTIAITAGAIFYLDFIGEDV
LHICMFALGCLIAFLGVFLITRNRKKPIPFEPYISMDAMPGMQNMHDKGMTVQPELKASF
SYGALENNDNISEIYAPATLPVMQEEHGSRSASGVPYRVLEHTKKE
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atggacggatcccacagcgcagccctgaagctgcagcagctgcctcccacaagtagctcc
agcgccgtaagcgaggcctccttctcctacaaggaaaacctgattggcgccctcttggcg
atcttcgggcacctcgtggtcagcattgcacttaacctccagaagtactgccacatccgc
ctggcaggctccaaggatccccgggcctatttcaagaccaagacatggtggctgggcctg
ttcctgatgcttctgggcgagctgggtgtgttcgcctcctacgccttcgcgccgctgtca
ctcatcgtgcccctcagcgcagtttctgtgatagctagtgccatcataggaatcatattc
atcaaggaaaagtggaaaccgaaagactttctgaggcgctacgtcttgtcctttgttggc
tgcggtttggctgtcgtgggtacctacctgctggtgacattcgcacccaacagtcacgag
aagatgacaggcgagaatgtcaccaggcacctcgtgagctggcctttccttttgtacatg
ctggtggagatcattctgttctgcttgctgctctacttctacaaggagaagaacgccaac
aacattgtcgtgattcttctcttggtggcgttacttggctccatgacagtggtgacagtc
aaggccgtggctgggatgcttgtcttgtccattcaagggaacctgcagcttgactacccc
atcttctacgtgatgttcgtgtgcatggtggcaaccgccgtctatcaggctgcgtttttg
agtcaagcctcacagatgtacgactcctctttgattgccagtgtgggctacattctgtcc
acaaccattgctatcacagcaggtgcaatattttacctggacttcatcggggaggacgtg
ctgcacatctgcatgtttgcactggggtgcctcattgcattcttgggcgtcttcttaatc
acgcgtaacaggaagaagcccattccatttgagccctatatttccatggatgccatgcca
ggtatgcagaacatgcacgataaagggatgactgtccagcctgaacttaaagcttctttt
tcctatggggctctggaaaacaatgacaacatttctgagatctacgctcctgccaccctg
ccagtcatgcaagaagagcacggctccagaagtgcctctggggtcccctaccgagtccta
gagcacaccaagaaggaatga

DBGET integrated database retrieval system