KEGG   Homo sapiens (human): 572Help
Entry
572               CDS       T01001                                 

Gene name
BAD, BBC2, BCL2L8
Definition
(RefSeq) BCL2 associated agonist of cell death
  KO
K02158  Bcl-2-antagonist of cell death
Organism
hsa  Homo sapiens (human)
Pathway
hsa01521  EGFR tyrosine kinase inhibitor resistance
hsa01522  Endocrine resistance
hsa01524  Platinum drug resistance
hsa04012  ErbB signaling pathway
hsa04014  Ras signaling pathway
hsa04022  cGMP-PKG signaling pathway
hsa04024  cAMP signaling pathway
hsa04140  Autophagy - animal
hsa04151  PI3K-Akt signaling pathway
hsa04210  Apoptosis
hsa04370  VEGF signaling pathway
hsa04510  Focal adhesion
hsa04722  Neurotrophin signaling pathway
hsa04910  Insulin signaling pathway
hsa04919  Thyroid hormone signaling pathway
hsa05010  Alzheimer's disease
hsa05014  Amyotrophic lateral sclerosis (ALS)
hsa05145  Toxoplasmosis
hsa05152  Tuberculosis
hsa05160  Hepatitis C
hsa05161  Hepatitis B
hsa05165  Human papillomavirus infection
hsa05200  Pathways in cancer
hsa05203  Viral carcinogenesis
hsa05210  Colorectal cancer
hsa05211  Renal cell carcinoma
hsa05212  Pancreatic cancer
hsa05213  Endometrial cancer
hsa05215  Prostate cancer
hsa05218  Melanoma
hsa05220  Chronic myeloid leukemia
hsa05221  Acute myeloid leukemia
hsa05223  Non-small cell lung cancer
hsa05225  Hepatocellular carcinoma
Network
N00030  EGF-EGFR-RAS-PI3K signaling pathway
N00031  Duplication-activated FLT3 to RAS-PI3K signaling pathway
N00032  Mutation-activated KRAS/NRAS to PI3K signaling pathway
N00033  EGF-EGFR-PI3K signaling pathway
N00036  Mutation-activated EGFR to PI3K signaling pathway
N00044  Mutation-activated MET to PI3K signaling pathway
N00046  Mutation-activated KIT to PI3K signaling pathway
N00047  EML4-ALK fusion kinase to PI3K signaling pathway
N00048  BCR-ABL fusion kinase to PI3K signaling pathway
N00082  Loss of NKX3-1 to PI3K signaling pathway
N00098  Intrinsic apoptotic pathway
N00247  HGF-overexpression to PI3K signaling pathway
N00249  MET-overexpression to PI3K signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    572 (BAD)
   04012 ErbB signaling pathway
    572 (BAD)
   04370 VEGF signaling pathway
    572 (BAD)
   04024 cAMP signaling pathway
    572 (BAD)
   04022 cGMP - PKG signaling pathway
    572 (BAD)
   04151 PI3K-Akt signaling pathway
    572 (BAD)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    572 (BAD)
  Cell growth and death
   04210 Apoptosis
    572 (BAD)
  Cellular community - eukaryotes
   04510 Focal adhesion
    572 (BAD)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    572 (BAD)
   04919 Thyroid hormone signaling pathway
    572 (BAD)
  Nervous system
   04722 Neurotrophin signaling pathway
    572 (BAD)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    572 (BAD)
   05203 Viral carcinogenesis
    572 (BAD)
   05210 Colorectal cancer
    572 (BAD)
   05212 Pancreatic cancer
    572 (BAD)
   05225 Hepatocellular carcinoma
    572 (BAD)
   05221 Acute myeloid leukemia
    572 (BAD)
   05220 Chronic myeloid leukemia
    572 (BAD)
   05218 Melanoma
    572 (BAD)
   05211 Renal cell carcinoma
    572 (BAD)
   05215 Prostate cancer
    572 (BAD)
   05213 Endometrial cancer
    572 (BAD)
   05223 Non-small cell lung cancer
    572 (BAD)
  Neurodegenerative diseases
   05010 Alzheimer's disease
    572 (BAD)
   05014 Amyotrophic lateral sclerosis (ALS)
    572 (BAD)
  Infectious diseases
   05152 Tuberculosis
    572 (BAD)
   05161 Hepatitis B
    572 (BAD)
   05160 Hepatitis C
    572 (BAD)
   05165 Human papillomavirus infection
    572 (BAD)
   05145 Toxoplasmosis
    572 (BAD)
  Drug resistance
   01521 EGFR tyrosine kinase inhibitor resistance
    572 (BAD)
   01524 Platinum drug resistance
    572 (BAD)
   01522 Endocrine resistance
    572 (BAD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Bcl-2_BAD Bclx_interact
Motif
Other DBs
NCBI-GeneID: 572
NCBI-ProteinID: NP_004313
OMIM: 603167
HGNC: 936
Ensembl: ENSG00000002330
Vega: OTTHUMG00000134302
Pharos: Q92934(Tchem)
UniProt: Q92934 A0A024R562
Position
11q13.1
AA seq 168 aa AA seqDB search
MFQIPEFEPSEQEDSSSAERGLGPSPAGDGPSGSGKHHRQAPGLLWDASHQQEQPTSSSH
HGGAGAVEIRSRHSSYPAGTEDDEGMGEEPSPFRGRSRSAPPNLWAAQRYGRELRRMSDE
FVDSFKKGLPRPKSAGTATQMRQSSSWTRVFQSWWDRNLGRGSSAPSQ
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
atgttccagatcccagagtttgagccgagtgagcaggaagactccagctctgcagagagg
ggcctgggccccagccccgcaggggacgggccctcaggctccggcaagcatcatcgccag
gccccaggcctcctgtgggacgccagtcaccagcaggagcagccaaccagcagcagccat
catggaggcgctggggctgtggagatccggagtcgccacagctcctaccccgcggggacg
gaggacgacgaagggatgggggaggagcccagcccctttcggggccgctcgcgctcggcg
ccccccaacctctgggcagcacagcgctatggccgcgagctccggaggatgagtgacgag
tttgtggactcctttaagaagggacttcctcgcccgaagagcgcgggcacagcaacgcag
atgcggcaaagctccagctggacgcgagtcttccagtcctggtgggatcggaacttgggc
aggggaagctccgccccctcccagtga

DBGET integrated database retrieval system