KEGG   Homo sapiens (human): 5721Help
Entry
5721              CDS       T01001                                 

Gene name
PSME2, PA28B, PA28beta, REGbeta
Definition
(RefSeq) proteasome activator subunit 2
  KO
K06697  proteasome activator subunit 2 (PA28 beta)
Organism
hsa  Homo sapiens (human)
Pathway
hsa03050  Proteasome
hsa04612  Antigen processing and presentation
Module
hsa_M00337  Immunoproteasome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   03050 Proteasome
    5721 (PSME2)
 Organismal Systems
  Immune system
   04612 Antigen processing and presentation
    5721 (PSME2)
Proteasome [BR:hsa03051]
 Eukaryotic proteasome
  Regulatory particles
   PA28 (11S REG)
    5721 (PSME2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PA28_beta PA28_alpha
Motif
Other DBs
NCBI-GeneID: 5721
NCBI-ProteinID: NP_002809
OMIM: 602161
HGNC: 9569
Ensembl: ENSG00000100911
Vega: OTTHUMG00000028797
Pharos: Q9UL46(Tbio)
UniProt: Q9UL46 Q86SZ7
Position
14q12
AA seq 239 aa AA seqDB search
MAKPCGVRLSGEARKQVEVFRQNLFQEAEEFLYRFLPQKIIYLNQLLQEDSLNVADLTSL
RAPLDIPIPDPPPKDDEMETDKQEKKEVHKCGFLPGNEKVLSLLALVKPEVWTLKEKCIL
VITWIQHLIPKIEDGNDFGVAIQEKVLERVNAVKTKVEAFQTTISKYFSERGDAVAKASK
ETHVMDYRALVHERDEAAYGELRAMVLDLRAFYAELYHIISSNLEKIVNPKGEEKPSMY
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atggccaagccgtgtggggtgcgcctgagcggggaagcccgcaaacaggtggaggtcttc
agacagaatcttttccaggaggctgaggaattcctctacagattcttgccacagaaaatc
atatacctgaatcagctcttgcaagaggactccctcaatgtggctgacttgacttccctc
cgggccccactggacatccccatcccagaccctccacccaaggatgatgagatggaaaca
gataagcaggagaagaaagaagtccataagtgtggatttctccctgggaatgagaaagtc
ctgtccctgcttgccctggttaagccagaagtctggactctcaaagagaaatgcattctg
gtgattacatggatccaacacctgatccccaagattgaagatggaaatgattttggggta
gcaatccaggagaaggtgctggagagggtgaatgccgtcaagaccaaagtggaagctttc
cagacaaccatttccaagtacttctcagaacgtggggatgctgtggccaaggcctccaag
gagactcatgtaatggattaccgggccttggtgcatgagcgagatgaggcagcctatggg
gagctcagggccatggtgctggacctgagggccttctatgctgagctttatcatatcatc
agcagcaacctggagaaaattgtcaacccaaagggtgaagaaaagccatctatgtactga

DBGET integrated database retrieval system