KEGG   Homo sapiens (human): 57216Help
Entry
57216             CDS       T01001                                 

Gene name
VANGL2, LPP1, LTAP, STB1, STBM, STBM1
Definition
(RefSeq) VANGL planar cell polarity protein 2
  KO
K04510  vang-like
Organism
hsa  Homo sapiens (human)
Pathway
hsa04310  Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    57216 (VANGL2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Strabismus MtN3_slv
Motif
Other DBs
NCBI-GeneID: 57216
NCBI-ProteinID: NP_065068
OMIM: 600533
HGNC: 15511
Ensembl: ENSG00000162738
Vega: OTTHUMG00000033122
Pharos: Q9ULK5(Tbio)
UniProt: Q9ULK5 A8K4L6
Position
1q23.2
AA seq 521 aa AA seqDB search
MDTESQYSGYSYKSGHSRSSRKHRDRRDRHRSKSRDGGRGDKSVTIQAPGEPLLDNESTR
GDERDDNWGETTTVVTGTSEHSISHDDLTRIAKDMEDSVPLDCSRHLGVAAGATLALLSF
LTPLAFLLLPPLLWREELEPCGTACEGLFISVAFKLLILLLGSWALFFRRPKASLPRVFV
LRALLMVLVFLLVVSYWLFYGVRILDARERSYQGVVQFAVSLVDALLFVHYLAVVLLELR
QLQPQFTLKVVRSTDGASRFYNVGHLSIQRVAVWILEKYYHDFPVYNPALLNLPKSVLAK
KVSGFKVYSLGEENSTNNSTGQSRAVIAAAARRRDNSHNEYYYEEAEHERRVRKRRARLV
VAVEEAFTHIKRLQEEEQKNPREVMDPREAAQAIFASMARAMQKYLRTTKQQPYHTMESI
LQHLEFCITHDMTPKAFLERYLAAGPTIQYHKERWLAKQWTLVSEEPVTNGLKDGIVFLL
KRQDFSLVVSTKKVPFFKLSEEFVDPKSHKFVMRLQSETSV
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atggacaccgagtcccagtactcgggctattcctacaagtcgggccactcccgcagctcc
cgcaagcacagggaccgccgggaccgacaccgctctaagagtcgagatgggggccgaggg
gacaagtcggtgacaatccaggctcccggggagcccctgctggacaatgagtccacacga
ggggatgagcgggatgacaactggggggaaacgacgacagtagtaacgggcacctcagag
cacagcatctcccatgatgacctcacacgcatcgccaaggacatggaggacagtgtccct
ctggactgctcccgtcacctgggtgtggcagcgggggccaccctggcactgctgtctttc
ctcacgcctctggccttcctgctgctgcccccactgctgtggcgggaggagctggagcct
tgcgggacggcctgcgagggcctcttcatctctgtcgccttcaagctgctcatcctgcta
ctgggcagctgggctctgttcttccgccggcccaaggcctcgctgccccgcgtctttgtg
ctgcgtgccctgcttatggtgctggttttcctgctcgtggtctcctactggctcttctat
ggtgtgcgcatcctggatgctcgggagcgcagctaccagggcgtggtgcagttcgccgtg
tcgctggtggacgcccttcttttcgtgcactacctggccgtggtcctgctggagctgcgc
cagctccagcctcagttcacgctcaaggtcgtgcgctccaccgacggcgccagccgcttc
tacaacgttggccatctcagcatccagcgcgtggcagtgtggatcctggagaagtattac
catgacttccctgtctacaaccctgccctcctcaacctgcccaagtccgtcctggccaag
aaagtgtctggcttcaaggtgtattccctcggagaggaaaacagcaccaacaactccact
ggccagtctcgggctgtgattgcagcggcagctcggaggcgggacaacagtcacaatgag
tactactatgaggaggctgagcatgagcgaagggtgcgcaagaggagggccaggcttgta
gtggcggtggaggaggccttcactcacattaagcggctgcaggaagaggagcagaaaaac
cccagggaggtgatggacccccgggaggcagcccaagccatctttgcatccatggcccgt
gccatgcagaagtaccttcggaccaccaagcagcagccctaccacaccatggagagcatc
ctgcagcaccttgaattctgcatcacgcatgacatgacgcccaaggccttcttggagcga
tacttggcggctggacctaccatccagtaccacaaggaacgctggctggccaaacagtgg
acattggtgagcgaggagccggtgaccaacggcctcaaggatggcatcgttttcctctta
aaacgccaggacttcagcctggtggtcagcaccaagaaggtcccattcttcaaactctcc
gaggaatttgtggatcccaagtcacacaagtttgtcatgaggctgcagtctgagacctca
gtgtga

DBGET integrated database retrieval system