KEGG   Homo sapiens (human): 57224
Entry
57224             CDS       T01001                                 
Symbol
NHSL1, C6orf63
Name
(RefSeq) NHS like 1
  KO
K24144  Nance-Horan syndrome protein and NHS-like proteins
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    57224 (NHSL1)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     57224 (NHSL1)
SSDB
Motif
Pfam: NHS
Other DBs
NCBI-GeneID: 57224
NCBI-ProteinID: NP_065197
OMIM: 620171
HGNC: 21021
Ensembl: ENSG00000135540
UniProt: Q5SYE7
Position
6:complement(138422043..138693212)
AA seq 1610 aa
MKKEGSSGSFRLQPNTGSLSRAVSWINFSSLSRQTKRLFRSDGELSVCGQQVEVDDENWI
YRAQPRKAVSNLDEESRWTVHYTAPWHQQENVFLPTTRPPCVEDLHRQAKLNLKSVLREC
DKLRHDGYRSSQYYSQGPTFAANASPFCDDYQDEDEETDQKCSLSSSEEERFISIRRPKT
PASSDFSDLNTQTNWTKSLPLPTPEEKMRQQAQTVQADVVPINITASGTGQDDADGHSVY
TPDHYSTLGRFNSCRSAGQRSETRDSSCQTEDVKVVPPSMRRIRAQKGQGIAAQMGHFSG
SSGNMSVLSDSAGIVFPSRLDSDAGFHSLPRSGARANIQSLEPRLGALGPAGDMNGTFLY
QRGHPQADENLGHLGGASGTGTLLRPKSQELRHFESENIMSPACVVSPHATYSTSIIPNA
TLSSSSEVIAIPTAQSAGQRESKSSGSSHARIKSRDHLISRHAVKGDPQSPGRHWNEGHA
TILSQDLDPHSPGEPALLSLCDSAVPLNAPANRENGSQAMPYNCRNNLAFPAHPQDVDGK
SESSYSGGGGHSSSEPWEYKSSGNGRASPLKPHLATPGYSTPTSNMSSCSLDQTSNKEDA
GSLYSEDHDGYCASVHTDSGHGSGNLCNSSDGFGNPRHSVINVFVGRAQKNQGDRSNYQD
KSLSRNISLKKAKKPPLPPSRTDSLRRIPKKSSQCNGQVLNESLIATLQHSLQLSLPGKS
GSSPSQSPCSDLEEPWLPRSRSQSTVSAGSSMTSATTPNVYSLCGATPSQSDTSSVKSEY
TDPWGYYIDYTGMQEDPGNPAGGCSTSSGVPTGNGPVRHVQEGSRATMPQVPGGSVKPKI
MSPEKSHRVISPSSGYSSQSNTPTALTPVPVFLKSVSPANGKGKPKPKVPERKSSLISSV
SISSSSTSLSSSTSTEGSGTMKKLDPAVGSPPAPPPPPVPSPPFPCPADRSPFLPPPPPV
TDCSQGSPLPHSPVFPPPPPEALIPFCSPPDWCLSPPRPALSPILPDSPVSLPLPPPLLP
SSEPPPAPPLDPKFMKDTRPPFTNSGQPESSRGSLRPPSTKEETSRPPMPLITTEALQMV
QLRPVRKNSGAEAAQLSERTAQEQRTPVAPQYHLKPSAFLKSRNSTNEMESESQPASVTS
SLPTPAKSSSQGDHGSAAERGGPVSRSPGAPSAGEAEARPSPSTTPLPDSSPSRKPPPIS
KKPKLFLVVPPPQKDFAVEPAENVSEALRAVPSPTTGEEGSVHSREAKESSAAQAGSHAT
HPGTSVLEGGAAGSMSPSRVEANVPMVQPDVSPAPKQEEPAENSADTGGDGESCLSQQDG
AAGVPETNAAGSSSEACDFLKEDGNDEVMTPSRPRTTEDLFAAIHRSKRKVLGRRDSDDD
HSRNHSPSPPVTPTGAAPSLASPKQVGSIQRSIRKSSTSSDNFKALLLKKGSRSDTSARM
SAAEMLKNTDPRFQRSRSEPSPDAPESPSSCSPSKNRRAQEEWAKNEGLMPRSLSFSGPR
YGRSRTPPSAASSRYSMRNRIQSSPMTVISEGEGEAVEPVDSIARGALGAAEGCSLDGLA
REEMDEGGLLCGEGPAASLQPQAPGPVDGTASAEGREPSPQCGGSLSEES
NT seq 4833 nt   +upstreamnt  +downstreamnt
atgaaaaaggaaggctcttcaggttccttcagactccagccgaatacaggttctctctca
cgtgctgtaagttggataaatttctcctccttgtccaggcagacaaagaggctgtttcgc
agtgatggagagctctcggtttgtgggcagcaggtggaagtggatgacgaaaactggata
tacagagcccagcccagaaaagcggtttccaacctagatgaggaaagccgatggacagtc
cactacactgccccgtggcaccagcaggagaatgtgttccttcccaccacaagacccccc
tgtgttgaggacctgcaccgccaagccaagctcaacctcaaatcagtactgagggaatgc
gataagttgcggcatgatggctaccgcagttctcagtactactctcagggacccaccttt
gcggccaacgccagcccattctgtgatgattaccaagatgaagatgaagaaacagatcaa
aagtgttctctgtcttcatcagaagaagaaagatttatttccatcaggagacctaaaaca
ccagcctcaagtgacttctccgaccttaatactcagacgaactggaccaagtcgcttcca
ctgccaacaccagaagagaagatgcgacagcaagcccaaacagtccaggctgacgtggtg
cctattaacataactgcatcaggcactggccaagatgatgctgatggccactcagtgtac
acccctgatcactactctacactaggaaggttcaatagctgtcggtctgctgggcagcgc
tcagaaaccagggactccagctgtcagacggaggatgtgaaggtcgtaccaccttccatg
aggagaatcagggcacagaaggggcaaggcattgctgcccagatgggccacttctcaggt
tcctctggcaacatgtctgtgctgagcgattctgcagggatcgtattcccttcccgcctt
gacagtgatgctggcttccatagtcttccgcgttctggagcaagggcaaacattcagtcc
cttgagccgaggctgggtgccctcggccctgcaggagacatgaatggcactttcctctac
cagagaggtcacccacaagcagatgaaaacttaggccatttaggaggtgcctcagggact
ggaacacttttgagacccaaatcccaggagttgagacacttcgagagtgaaaatataatg
agcccagcgtgtgtggtttctcctcatgcaacctactccaccagcatcatcccaaatgcc
acactgtcttcctcttccgaggtcatcgctattcccactgctcagagtgcgggacagcgg
gaaagtaaaagttctggctcatcacatgcaaggataaaatccagagaccacctcatctcc
aggcatgctgtgaaaggtgatcctcagtctcccggtcgccactggaatgagggccatgcc
accattctttcacaggacttagaccctcattcccctggtgaacccgcactgttgtccctc
tgtgactcagccgtccctctaaatgctccagcaaatagggagaatgggtcccaagctatg
ccgtataattgtagaaacaacctggccttcccagcccacccccaagatgtggatggcaag
agtgaatctagttattcagggggcggagggcacagcagctcggagccctgggaatacaaa
tcctcaggtaatggaagggcatcccccctgaagccgcatttagcaactcctggctattcc
actcccacaagtaacatgagcagctgcagtttggaccaaacgtccaacaaagaggatgct
gggtcgctgtattctgaggaccacgatggctactgtgcatctgtgcacactgactctgga
catggatctgggaatctgtgcaatagcagtgatggctttgggaaccccaggcacagcgtg
atcaatgtttttgttggaagagctcagaaaaaccaaggggaccggtccaattaccaggat
aaatccctatcaagaaacatctctttgaagaaagcaaagaagcctcccctgccaccctcc
cggacagactccctccgcaggattcccaagaagagcagccagtgcaacgggcaggtgctc
aacgagagcctgatcgccacactccagcactcgctgcagctgagcctcccaggcaagagt
ggcagctcgccctcccagagcccctgcagtgacttggaagagccctggctgccccgctcc
cggagccagagcacagttagtgctggcagcagcatgacttccgccaccacccccaatgtc
tactccctgtgcggggccacgccatcgcagagtgacacaagcagcgtcaagtcagagtac
acggacccctggggttattacattgactacacgggcatgcaggaagatccggggaacccg
gcagggggctgttcaaccagcagtggggtgcccactgggaacgggccagtccgccatgtc
caagaagggtccagagccacaatgccccaagtgcccggtggttcagtcaaaccaaagatc
atgtcaccagagaagtcacacagagtcatttctccatccagtgggtattccagccagtcg
aatacacccacagcactcacccctgtgcctgtgtttttaaaatcagtgtcaccagcaaac
gggaaggggaagcccaagcccaaggtaccagaaaggaagtcctctctgatatcttcagta
tccatttcctcatcgtccacttctctttcttctagtacttctactgaaggaagtggcact
atgaagaagctggatccagccgtgggctctcccccggctcctcctcctcctcctgttccc
tctcctccattcccttgtcctgcagacaggtctcctttccttcctcccccacctcctgtc
acagattgctcccagggctctcctctgcctcactctcctgtgttcccccctccgccgcca
gaagctctcattcctttctgctccccacctgattggtgcctttctcctccccgccctgca
ctgagccccattcttccagattcacctgtgtccttgccattgcccccacctctcttacct
tcctcggaacccccacctgccccacctcttgaccccaaattcatgaaagacaccaggccg
cctttcacaaattctggccagccagaatcctcccggggatccttgaggccgccttctacc
aaggaggagaccagcaggccccccatgcccctgataaccacggaagcattgcagatggtg
cagttgaggcccgtgagaaagaactcaggcgctgaggcggcacagttgtctgaacgaaca
gctcaggaacaacgaactccagttgctccacagtaccacttaaagccatctgctttcctg
aaatcccgaaatagcacaaatgaaatggagagtgaaagccagcctgcctctgtgacaagc
tcgcttccgacgcctgccaagagctcgagtcagggtgaccatggcagtgcggctgagcgt
ggtggccctgtgagccgcagccctggagctccaagcgctggggaggcagaggctcggccc
agccccagcaccaccccactcccagactcttcacccagcaggaagccaccccccatttcc
aagaagcccaaactgttcctggtggtaccacctccgcagaaagattttgcagtggagccc
gcagagaacgtgagcgaagccctccgagctgtgcccagccccacgacgggagaggagggc
tctgtgcacagcagggaggcaaaagagagttctgcagcccaagctggctctcatgccacg
caccctggcacctcggttcttgagggaggagctgcaggatccatgtctcccagcagagtg
gaagccaatgtccccatggttcagcctgatgtctcaccagcccccaagcaggaggagcca
gccgagaacagtgcggatactgggggcgatggggagagctgcctatctcaacaggacgga
gcagctggggtgccggagaccaacgcagccggttcatcctcagaggcctgtgacttcctc
aaggaagacgggaatgatgaggtaatgacccccagtcgacccaggaccacagaagacctt
tttgcagctattcacagatccaaaaggaaagtcctcggccgtagagattcagatgatgac
cactcccgaaaccattctccctccccgcccgtgacacccaccggcgctgccccaagcctg
gcctctccaaagcaagtggggtcgattcagagaagcatccgaaagagcagcaccagcagt
gacaacttcaaagctctgctgctgaaaaagggcagtcgttcagacaccagcgcccgcatg
tctgcagcagagatgctcaagaacacagaccctagattccagaggtcgaggtcagagcct
tccccagatgcccccgagagcccgtcaagctgctccccaagcaagaacagaagggcgcag
gaggagtgggccaagaacgaaggcttgatgcctcggagtctgtccttttccggccccagg
tacggccgcagccgaacgccgccttctgccgccagcagcaggtacagcatgcggaaccgg
atccagagcagccccatgaccgtcatctcggagggagaaggggaagccgtggagcctgtg
gacagcatagcccgcggggctctgggcgctgcggagggatgttccctggacggactggcg
agggaggagatggacgagggcggcctgctctgtggggaggggcctgccgcctccctgcag
ccccaggcccccggccctgtggatgggacagccagtgcagagggcagagagccctcccca
cagtgtggcggttctctgagcgaggagagttag

DBGET integrated database retrieval system