KEGG   Homo sapiens (human): 5723
Entry
5723              CDS       T01001                                 

Gene name
PSPH, PSP, PSPHD
Definition
(RefSeq) phosphoserine phosphatase
  KO
K01079  phosphoserine phosphatase [EC:3.1.3.3]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00260  Glycine, serine and threonine metabolism
hsa01100  Metabolic pathways
hsa01200  Carbon metabolism
hsa01230  Biosynthesis of amino acids
Module
hsa_M00020  Serine biosynthesis, glycerate-3P => serine
Disease
H02116  Phosphoserine phosphatase deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    5723 (PSPH)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    5723 (PSPH)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.3  phosphoserine phosphatase
     5723 (PSPH)
Protein phosphatases and associated proteins [BR:hsa01009]
 HAD phosphatases
  Other HAD phosphatases
   5723 (PSPH)
SSDB
Motif
Pfam: Hydrolase HAD UMPH-1 HAD_2 Put_Phosphatase StbA Acid_phosphat_B
Other DBs
NCBI-GeneID: 5723
NCBI-ProteinID: NP_004568
OMIM: 172480
HGNC: 9577
Ensembl: ENSG00000146733
Vega: OTTHUMG00000023441
Pharos: P78330(Tbio)
UniProt: P78330 A0A024RDL3
Structure
PDB: 

Position
7p11.2
AA seq 225 aa
MVSHSELRKLFYSADAVCFDVDSTVIREEGIDELAKICGVEDAVSEMTRRAMGGAVPFKA
ALTERLALIQPSREQVQRLIAEQPPHLTPGIRELVSRLQERNVQVFLISGGFRSIVEHVA
SKLNIPATNVFANRLKFYFNGEYAGFDETQPTAESGGKGKVIKLLKEKFHFKKIIMIGDG
ATDMEACPPADAFIGFGGNVIRQQVKDNAKWYITDFVELLGELEE
NT seq 678 nt   +upstreamnt  +downstreamnt
atggtctcccactcagagctgaggaagcttttctactcagcagatgctgtgtgttttgat
gttgacagcacggtcatcagagaagaaggaatcgatgagctagccaaaatctgtggcgtt
gaggacgcggtgtcagaaatgacacggcgagccatgggcggggcagtgcctttcaaagct
gctctcacagagcgcttagccctcatccagccctccagggagcaggtgcagagactcata
gcagagcaacccccacacctgacccccggcataagggagctggtaagtcgcctacaggag
cgaaatgttcaggttttcctaatatctggtggctttaggagtattgtagagcatgttgct
tcaaagctcaatatcccagcaaccaatgtatttgccaataggctgaaattctactttaac
ggtgaatatgcaggttttgatgagacgcagccaacagctgaatctggtggaaaaggaaaa
gtgattaaacttttaaaggaaaaatttcattttaagaaaataatcatgattggagatggt
gccacagatatggaagcctgtcctcctgctgatgctttcattggatttggaggaaatgtg
atcaggcaacaagtcaaggataacgccaaatggtatatcactgattttgtagagctgctg
ggagaactggaagaataa

DBGET integrated database retrieval system